UniProt ID | TPRKB_HUMAN | |
---|---|---|
UniProt AC | Q9Y3C4 | |
Protein Name | EKC/KEOPS complex subunit TPRKB {ECO:0000305} | |
Gene Name | TPRKB {ECO:0000312|HGNC:HGNC:24259} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 175 | |
Subcellular Localization | Cytoplasm, cytosol . Nucleus . | |
Protein Description | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. [PubMed: 22912744] | |
Protein Sequence | MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
21 (in isoform 3) | Ubiquitination | - | 62.67 | - | |
21 | Ubiquitination | RVTLLLFKDVKNAGD HEEEEEECCCCCHHH | 62.67 | 33845483 | |
24 (in isoform 3) | Ubiquitination | - | 51.73 | - | |
24 | Ubiquitination | LLLFKDVKNAGDLRR EEEECCCCCHHHHHH | 51.73 | 33845483 | |
33 | Ubiquitination | AGDLRRKAMEGTIDG HHHHHHHHHCCCCCC | 10.23 | 29967540 | |
48 | Ubiquitination | SLINPTVIVDPFQIL CCCCCEEEECHHHHH | 2.98 | 29967540 | |
61 (in isoform 3) | Phosphorylation | - | 8.18 | 29978859 | |
61 | Ubiquitination | ILVAANKAVHLYKLG HHHHHHHHHHHHHCC | 8.18 | 21963094 | |
61 (in isoform 2) | Ubiquitination | - | 8.18 | 21906983 | |
62 | Ubiquitination | LVAANKAVHLYKLGK HHHHHHHHHHHHCCC | 3.23 | 22817900 | |
64 (in isoform 3) | Phosphorylation | - | 3.03 | 29978859 | |
66 (in isoform 3) | Phosphorylation | - | 58.06 | 29978859 | |
66 | Ubiquitination | NKAVHLYKLGKMKTR HHHHHHHHCCCCCCC | 58.06 | 29967540 | |
67 (in isoform 3) | Phosphorylation | - | 5.14 | 29978859 | |
69 (in isoform 3) | Phosphorylation | - | 47.89 | 29978859 | |
76 | Phosphorylation | KMKTRTLSTEIIFNL CCCCCCCEEEEEEEC | 24.31 | 19369195 | |
76 | Ubiquitination | KMKTRTLSTEIIFNL CCCCCCCEEEEEEEC | 24.31 | 21963094 | |
77 | Ubiquitination | MKTRTLSTEIIFNLS CCCCCCEEEEEEECC | 34.02 | 22817900 | |
77 | Phosphorylation | MKTRTLSTEIIFNLS CCCCCCEEEEEEECC | 34.02 | - | |
94 | Ubiquitination | NNISEALKKFGISAN CCHHHHHHHHCCCCC | 53.77 | 21906983 | |
94 (in isoform 1) | Ubiquitination | - | 53.77 | 21906983 | |
95 | Ubiquitination | NISEALKKFGISAND CHHHHHHHHCCCCCC | 50.07 | 22817900 | |
99 | Phosphorylation | ALKKFGISANDTSIL HHHHHCCCCCCCEEE | 22.77 | 27762562 | |
101 (in isoform 2) | Ubiquitination | - | 46.43 | 21906983 | |
101 | Ubiquitination | KKFGISANDTSILIV HHHCCCCCCCEEEEE | 46.43 | 21963094 | |
105 | Ubiquitination | ISANDTSILIVYIEE CCCCCCEEEEEEEEC | 3.10 | 29967540 | |
105 (in isoform 3) | Ubiquitination | - | 3.10 | - | |
113 (in isoform 2) | Ubiquitination | - | 34.31 | 21906983 | |
113 | Ubiquitination | LIVYIEEGEKQINQE EEEEEECCCEEECHH | 34.31 | 22817900 | |
114 | Ubiquitination | IVYIEEGEKQINQEY EEEEECCCEEECHHH | 45.10 | 22817900 | |
116 | Ubiquitination | YIEEGEKQINQEYLI EEECCCEEECHHHHH | 35.25 | 21963094 | |
117 | Ubiquitination | IEEGEKQINQEYLIS EECCCEEECHHHHHH | 9.47 | 22817900 | |
121 | Phosphorylation | EKQINQEYLISQVEG CEEECHHHHHHEECC | 10.28 | 19060867 | |
124 | Phosphorylation | INQEYLISQVEGHQV ECHHHHHHEECCCCC | 26.11 | 22798277 | |
128 | Ubiquitination | YLISQVEGHQVSLKN HHHHEECCCCCCCCC | 20.05 | 22817900 | |
129 | Ubiquitination | LISQVEGHQVSLKNL HHHEECCCCCCCCCC | 16.03 | 22817900 | |
132 | Phosphorylation | QVEGHQVSLKNLPEI EECCCCCCCCCCHHH | 27.36 | 19060867 | |
132 | Ubiquitination | QVEGHQVSLKNLPEI EECCCCCCCCCCHHH | 27.36 | 22817900 | |
133 (in isoform 3) | Ubiquitination | - | 4.47 | 21906983 | |
133 | Ubiquitination | VEGHQVSLKNLPEIM ECCCCCCCCCCHHHH | 4.47 | 21963094 | |
134 | Ubiquitination | EGHQVSLKNLPEIMN CCCCCCCCCCHHHHC | 49.27 | 21906983 | |
134 (in isoform 1) | Ubiquitination | - | 49.27 | 21906983 | |
140 | Sulfoxidation | LKNLPEIMNITEVKK CCCCHHHHCHHHHHH | 2.57 | 21406390 | |
143 | Phosphorylation | LPEIMNITEVKKIYK CHHHHCHHHHHHHHH | 29.71 | 22798277 | |
146 (in isoform 1) | Ubiquitination | - | 27.50 | 21906983 | |
146 | Ubiquitination | IMNITEVKKIYKLSS HHCHHHHHHHHHHCC | 27.50 | 27667366 | |
147 | Ubiquitination | MNITEVKKIYKLSSQ HCHHHHHHHHHHCCC | 57.34 | 22817900 | |
150 | Ubiquitination | TEVKKIYKLSSQEES HHHHHHHHHCCCHHH | 45.42 | 22817900 | |
152 | Phosphorylation | VKKIYKLSSQEESIG HHHHHHHCCCHHHHH | 26.31 | 20068231 | |
153 | Phosphorylation | KKIYKLSSQEESIGT HHHHHHCCCHHHHHH | 52.64 | 28348404 | |
157 | Phosphorylation | KLSSQEESIGTLLDA HHCCCHHHHHHHHHH | 26.09 | 20068231 | |
160 | Phosphorylation | SQEESIGTLLDAIIC CCHHHHHHHHHHHHH | 23.60 | 20068231 | |
171 | Phosphorylation | AIICRMSTKDVL--- HHHHCCCCCCCC--- | 23.17 | 19369195 | |
172 | Ubiquitination | IICRMSTKDVL---- HHHCCCCCCCC---- | 38.23 | - | |
173 | Ubiquitination | ICRMSTKDVL----- HHCCCCCCCC----- | 47.22 | 21963094 | |
173 (in isoform 3) | Ubiquitination | - | 47.22 | 21906983 | |
185 | Ubiquitination | ----------------- ----------------- | 22817900 | ||
185 (in isoform 3) | Ubiquitination | - | 21906983 | ||
186 | Ubiquitination | ------------------ ------------------ | 22817900 | ||
189 (in isoform 3) | Ubiquitination | - | - | ||
189 | Ubiquitination | --------------------- --------------------- | 22817900 | ||
211 (in isoform 3) | Ubiquitination | - | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TPRKB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TPRKB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TPRKB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PRPK_HUMAN | TP53RK | physical | 16189514 | |
PRPK_HUMAN | TP53RK | physical | 12659830 | |
OSGEP_HUMAN | OSGEP | physical | 22912744 | |
LAGE3_HUMAN | LAGE3 | physical | 22912744 | |
PRPK_HUMAN | TP53RK | physical | 22912744 | |
UBE2S_HUMAN | UBE2S | physical | 22939629 | |
TRM1_HUMAN | TRMT1 | physical | 22939629 | |
ARPC4_HUMAN | ARPC4 | physical | 22863883 | |
ARPC5_HUMAN | ARPC5 | physical | 22863883 | |
HSF1_HUMAN | HSF1 | physical | 22863883 | |
HPBP1_HUMAN | HSPBP1 | physical | 22863883 | |
KBP_HUMAN | KIAA1279 | physical | 22863883 | |
TRMB_HUMAN | METTL1 | physical | 22863883 | |
NIF3L_HUMAN | NIF3L1 | physical | 22863883 | |
KAPCB_HUMAN | PRKACB | physical | 22863883 | |
RAGP1_HUMAN | RANGAP1 | physical | 22863883 | |
SH3G1_HUMAN | SH3GL1 | physical | 22863883 | |
SHLB1_HUMAN | SH3GLB1 | physical | 22863883 | |
PRPK_HUMAN | TP53RK | physical | 22863883 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Large-scale proteomics analysis of the human kinome."; Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.; Mol. Cell. Proteomics 8:1751-1764(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-76; TYR-121; SER-132 ANDSER-152, AND MASS SPECTROMETRY. |