UniProt ID | GON7_HUMAN | |
---|---|---|
UniProt AC | Q9BXV9 | |
Protein Name | EKC/KEOPS complex subunit GON7 {ECO:0000305} | |
Gene Name | GON7 {ECO:0000312|HGNC:HGNC:20356} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 100 | |
Subcellular Localization | Nucleus . | |
Protein Description | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. GON7 likely plays a supporting role to the catalytic subunit OSGEP in the complex.. | |
Protein Sequence | MELLGEYVGQEGKPQKLRVSCEAPGDGDPFQGLLSGVAQMKDMVTELFDPLVQGEVQHRVAAAPDEDLDGDDEDDAEDENNIDNRTNFDGPSAKRPKTPS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MELLGEYV -------CCCHHHHC | 22814378 | ||
13 | Ubiquitination | EYVGQEGKPQKLRVS HHCCCCCCCCEEEEE | 24816145 | ||
20 | Phosphorylation | KPQKLRVSCEAPGDG CCCEEEEEEECCCCC | 27690223 | ||
35 | Phosphorylation | DPFQGLLSGVAQMKD CHHHHHHHHHHHHHH | 25022875 | ||
92 | Phosphorylation | RTNFDGPSAKRPKTP CCCCCCCCCCCCCCC | 26074081 | ||
94 | Acetylation | NFDGPSAKRPKTPS- CCCCCCCCCCCCCC- | 25953088 | ||
94 | Ubiquitination | NFDGPSAKRPKTPS- CCCCCCCCCCCCCC- | 24816145 | ||
97 | Ubiquitination | GPSAKRPKTPS---- CCCCCCCCCCC---- | 24816145 | ||
98 | Phosphorylation | PSAKRPKTPS----- CCCCCCCCCC----- | 30576142 | ||
100 | Phosphorylation | AKRPKTPS------- CCCCCCCC------- | 30576142 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GON7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GON7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GON7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GPN1_HUMAN | GPN1 | physical | 22863883 | |
HSF1_HUMAN | HSF1 | physical | 22863883 | |
HPBP1_HUMAN | HSPBP1 | physical | 22863883 | |
OGT1_HUMAN | OGT | physical | 22863883 | |
PPME1_HUMAN | PPME1 | physical | 22863883 | |
TPRKB_HUMAN | TPRKB | physical | 22863883 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...