UniProt ID | CC28B_HUMAN | |
---|---|---|
UniProt AC | Q9BUN5 | |
Protein Name | Coiled-coil domain-containing protein 28B | |
Gene Name | CCDC28B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 200 | |
Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . It localizes near centrosomes and basal bodies. | |
Protein Description | Involved in ciliogenesis. Regulates cilia length through its interaction with MAPKAP1/SIN1 but independently of mTORC2 complex. Modulates mTORC2 complex assembly and function, possibly enhances AKT1 phosphorylation. Does not seem to modulate assembly and function of mTORC1 complex.. | |
Protein Sequence | MDDKKKKRSPKPCLAQPAQAPGTLRRVPVPTSHSGSLALGLPHLPSPKQRAKFKRVGKEKCRPVLAGGGSGSAGTPLQHSFLTEVTDVYEMEGGLLNLLNDFHSGRLQAFGKECSFEQLEHVREMQEKLARLHFSLDVCGEEEDDEEEEDGVTEGLPEEQKKTMADRNLDQLLSNLEDLSNSIQKLHLAENAEPEEQSAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDDKKKKR -------CCHHHCCC | 15.78 | 22814378 | |
9 | Phosphorylation | DDKKKKRSPKPCLAQ CHHHCCCCCCCCCCC | 46.27 | 28464451 | |
23 | Phosphorylation | QPAQAPGTLRRVPVP CCCCCCCCEEECCCC | 18.94 | - | |
31 | Phosphorylation | LRRVPVPTSHSGSLA EEECCCCCCCCCCEE | 39.03 | 27080861 | |
32 | Phosphorylation | RRVPVPTSHSGSLAL EECCCCCCCCCCEEC | 15.02 | 27080861 | |
34 | Phosphorylation | VPVPTSHSGSLALGL CCCCCCCCCCEECCC | 29.82 | 27080861 | |
36 | Phosphorylation | VPTSHSGSLALGLPH CCCCCCCCEECCCCC | 17.30 | 27080861 | |
46 | Phosphorylation | LGLPHLPSPKQRAKF CCCCCCCCHHHHHHH | 51.60 | 29255136 | |
70 | Phosphorylation | PVLAGGGSGSAGTPL EEECCCCCCCCCCCC | 32.61 | - | |
75 | Phosphorylation | GGSGSAGTPLQHSFL CCCCCCCCCCCCHHH | 22.12 | - | |
80 | Phosphorylation | AGTPLQHSFLTEVTD CCCCCCCHHHCCCCE | 14.70 | - | |
112 | Ubiquitination | GRLQAFGKECSFEQL CCHHHHCCCCCHHHH | 49.44 | 29967540 | |
115 | Phosphorylation | QAFGKECSFEQLEHV HHHCCCCCHHHHHHH | 32.67 | 26437602 | |
174 | Phosphorylation | RNLDQLLSNLEDLSN CCHHHHHHCHHHHHH | 48.22 | 27174698 | |
180 | Phosphorylation | LSNLEDLSNSIQKLH HHCHHHHHHHHHHHH | 40.63 | 27174698 | |
182 | Phosphorylation | NLEDLSNSIQKLHLA CHHHHHHHHHHHHHH | 24.03 | 27174698 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CC28B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CC28B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CC28B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
ATRIP_HUMAN | ATRIP | physical | 25416956 | |
IFT74_HUMAN | IFT74 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
209900 | Bardet-Biedl syndrome (BBS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-46, AND MASSSPECTROMETRY. |