dbPTM

IZH4_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	IZH4_YEAST
UniProt AC	Q99393
Protein Name	ADIPOR-like receptor IZH4
Gene Name	IZH4
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	312
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	ADIPOR-like receptor involved in zinc metabolism either by altering membrane sterol content or by directly altering cellular zinc levels..
Protein Sequence	MVSLTTIEQSPVKCETTTEKESNDTRGTDSNENAETKETKKGFPFHDLAKLQKQYKNKSSRNESLVALIYLLGSMLSFCLLIFFTDFYLIPLFPTTTTMTDYIVFNFYLLNVFVFCMVHFIYHFVKNISLQQHLEHWQKFSYLSNINLLISSQITILYYLFYDYVFFFKIFTLLMNFIGLVAYFFILTDKLISSKRFNKTVFFISVSVVCCSLPLLTAIITFDGLENLKERIKVNAITWELVALVAASIIYVTRFPESLFRRNKKEEGWNHSEYLFHLLISGTAFYHFFILIQSYILMHSSLNQPELINFKS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
10	Phosphorylation	SLTTIEQSPVKCETT CCEEECCCCCCCEEC	20.90	28152593
20	Ubiquitination	KCETTTEKESNDTRG CCEECCCCCCCCCCC	65.43	23749301
37	Ubiquitination	SNENAETKETKKGFP CCCCCCCCHHCCCCC	55.69	23749301
40	Ubiquitination	NAETKETKKGFPFHD CCCCCHHCCCCCHHH	52.57	22817900
41	Ubiquitination	AETKETKKGFPFHDL CCCCHHCCCCCHHHH	73.53	22817900

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of IZH4_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of IZH4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of IZH4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PMT4_YEAST	PMT4	genetic	16269340
BSC6_YEAST	BSC6	genetic	16269340
INP54_YEAST	INP54	genetic	16269340
RDL1_YEAST	RDL1	genetic	16269340
DS1P2_YEAST	YSR3	genetic	16269340
HACD_YEAST	PHS1	genetic	16269340
ICE2_YEAST	ICE2	genetic	16269340
ARE1_YEAST	ARE1	genetic	16269340
BEM1_YEAST	BEM1	genetic	21987634
CYK2_YEAST	HOF1	genetic	21987634
INP54_YEAST	INP54	genetic	21987634
BSC6_YEAST	BSC6	genetic	21987634
POP7_YEAST	POP7	genetic	27708008
CDC10_YEAST	CDC10	genetic	27708008
UAP1_YEAST	QRI1	genetic	27708008
MAK21_YEAST	MAK21	genetic	27708008
TCPZ_YEAST	CCT6	genetic	27708008
SEC20_YEAST	SEC20	genetic	27708008
RSC8_YEAST	RSC8	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
NDC80_YEAST	NDC80	genetic	27708008
DPB11_YEAST	DPB11	genetic	27708008
KRE9_YEAST	KRE9	genetic	27708008
PRP21_YEAST	PRP21	genetic	27708008
IF2A_YEAST	SUI2	genetic	27708008
NUP85_YEAST	NUP85	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
PRS7_YEAST	RPT1	genetic	27708008
PRP19_YEAST	PRP19	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
GPI12_YEAST	GPI12	genetic	27708008
NOG2_YEAST	NOG2	genetic	27708008
SGT1_YEAST	SGT1	genetic	27708008
APC5_YEAST	APC5	genetic	27708008
PRS10_YEAST	RPT4	genetic	27708008
TBF1_YEAST	TBF1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of IZH4_YEAST

Related Literatures of Post-Translational Modification