dbPTM

COX19_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	COX19_YEAST
UniProt AC	Q3E731
Protein Name	Cytochrome c oxidase assembly protein COX19
Gene Name	COX19
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	98
Subcellular Localization	Cytoplasm. Mitochondrion intermembrane space .
Protein Description	Required for the assembly of mitochondrial cytochrome c oxidase..
Protein Sequence	MSGNPGSSLSALRPTPPERGSFPLDHDGECTKYMQEYLKCMQLVQNENAMNCRLLAKDYLRCRMDHQLMDYDEWSHLGLPEDAPGNNGKTIKDATDNK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
57	Acetylation	MNCRLLAKDYLRCRM HHHHHHHHHHHHHCC	47.04	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of COX19_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of COX19_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of COX19_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
KIN3_YEAST	KIN3	genetic	27708008
RV161_YEAST	RVS161	genetic	27708008
SNT1_YEAST	SNT1	genetic	27708008
PEX19_YEAST	PEX19	genetic	27708008
DLD1_YEAST	DLD1	genetic	27708008
UBX5_YEAST	UBX5	genetic	27708008
SNF1_YEAST	SNF1	genetic	27708008
AIM11_YEAST	AIM11	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
CSK2B_YEAST	CKB1	genetic	27708008
HOS2_YEAST	HOS2	genetic	27708008
YG37_YEAST	YGR127W	genetic	27708008
MPH1_YEAST	MPH1	genetic	27708008
INA22_YEAST	INA22	genetic	27708008
RL43A_YEAST	RPL43B	genetic	27708008
RL43B_YEAST	RPL43B	genetic	27708008
POC2_YEAST	ADD66	genetic	27708008
PRY2_YEAST	PRY2	genetic	27708008
UTH1_YEAST	UTH1	genetic	27708008
ACE2_YEAST	ACE2	genetic	27708008
ATP10_YEAST	ATP10	genetic	27708008
YL413_YEAST	INA1	genetic	27708008
ATP18_YEAST	ATP18	genetic	27708008
NU188_YEAST	NUP188	genetic	27708008
PFKA2_YEAST	PFK2	genetic	27708008
PUR1_YEAST	ADE4	genetic	27708008
ATP23_YEAST	ATP23	genetic	27708008
INO4_YEAST	INO4	genetic	27708008
SUCA_YEAST	LSC1	genetic	27708008
PDE2_YEAST	PDE2	genetic	27708008
SUR1_YEAST	SUR1	genetic	27708008
YME1_YEAST	YME1	genetic	27708008
COX11_YEAST	COX11	physical	25926683

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of COX19_YEAST

Related Literatures of Post-Translational Modification