UniProt ID | ARL15_HUMAN | |
---|---|---|
UniProt AC | Q9NXU5 | |
Protein Name | ADP-ribosylation factor-like protein 15 | |
Gene Name | ARL15 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 204 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSDLRITEAFLYMDYLCFRALCCKGPPPARPEYDLVCIGLTGSGKTSLLSKLCSESPDNVVSTTGFSIKAVPFQNAILNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILANHQDKPAARSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEEKDHEAVRM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
47 | Phosphorylation | LTGSGKTSLLSKLCS CCCCCHHHHHHHHHC | 30.69 | 24719451 | |
51 | Ubiquitination | GKTSLLSKLCSESPD CHHHHHHHHHCCCCC | 54.18 | 29967540 | |
53 | S-palmitoylation | TSLLSKLCSESPDNV HHHHHHHHCCCCCCE | 4.95 | 29575903 | |
92 | Phosphorylation | GADNIRKYWSRYYQG CHHHHHHHHHHHHCC | 9.96 | - | |
94 | Phosphorylation | DNIRKYWSRYYQGSQ HHHHHHHHHHHCCCC | 13.81 | - | |
156 | Ubiquitination | ARSVQEIKKYFELEP HHCHHHHHHHHCCCC | 40.44 | 23000965 | |
157 | Ubiquitination | RSVQEIKKYFELEPL HCHHHHHHHHCCCCH | 61.91 | 23000965 | |
158 | Ubiquitination | SVQEIKKYFELEPLA CHHHHHHHHCCCCHH | 9.40 | 23000965 | |
159 | Ubiquitination | VQEIKKYFELEPLAR HHHHHHHHCCCCHHC | 13.67 | 21890473 | |
175 | Ubiquitination | KRWILQPCSLDDMDA CCEEECCCCCCCHHH | 3.99 | 23000965 | |
176 | Ubiquitination | RWILQPCSLDDMDAL CEEECCCCCCCHHHH | 41.33 | 21890473 | |
197 | Ubiquitination | LINLLEEKDHEAVRM HHHHHHHHCCHHHCC | 55.82 | 29967540 | |
198 | Ubiquitination | INLLEEKDHEAVRM- HHHHHHHCCHHHCC- | 48.41 | 23000965 | |
199 | Ubiquitination | NLLEEKDHEAVRM-- HHHHHHCCHHHCC-- | 35.66 | 21890473 | |
217 | Ubiquitination | -------------------- -------------------- | 23000965 | ||
218 | Ubiquitination | --------------------- --------------------- | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ARL15_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARL15_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARL15_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...