| UniProt ID | AAR2_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y312 | |
| Protein Name | Protein AAR2 homolog | |
| Gene Name | AAR2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 384 | |
| Subcellular Localization | ||
| Protein Description | Component of the U5 snRNP complex that is required for spliceosome assembly and for pre-mRNA splicing.. | |
| Protein Sequence | MAAVQMDPELAKRLFFEGATVVILNMPKGTEFGIDYNSWEVGPKFRGVKMIPPGIHFLHYSSVDKANPKEVGPRMGFFLSLHQRGLTVLRWSTLREEVDLSPAPESEVEAMRANLQELDQFLGPYPYATLKKWISLTNFISEATVEKLQPENRQICAFSDVLPVLSMKHTKDRVGQNLPRCGIECKSYQEGLARLPEMKPRAGTEIRFSELPTQMFPEGATPAEITKHSMDLSYALETVLNKQFPSSPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLLCRSEAAMMKHHTLYINLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAVDATLRKKAEKFQAHLTKKFRWDFAAEPEDCAPVVVELPEGIEMG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAAVQMDPE ------CCCCCCCHH | 22223895 | ||
| 12 | Ubiquitination | QMDPELAKRLFFEGA CCCHHHHHHHHHCCC | 23000965 | ||
| 44 | Ubiquitination | NSWEVGPKFRGVKMI CCCCCCCCCCCCEEC | 21906983 | ||
| 49 | Ubiquitination | GPKFRGVKMIPPGIH CCCCCCCEECCCCEE | 22817900 | ||
| 60 | Phosphorylation | PGIHFLHYSSVDKAN CCEEEEECCCCCCCC | 25954137 | ||
| 61 | Phosphorylation | GIHFLHYSSVDKANP CEEEEECCCCCCCCH | 25954137 | ||
| 62 | Phosphorylation | IHFLHYSSVDKANPK EEEEECCCCCCCCHH | 25954137 | ||
| 92 | Phosphorylation | GLTVLRWSTLREEVD CCEEEEEHHHHHHCC | 24670416 | ||
| 93 | Phosphorylation | LTVLRWSTLREEVDL CEEEEEHHHHHHCCC | 24670416 | ||
| 101 | Phosphorylation | LREEVDLSPAPESEV HHHHCCCCCCCHHHH | 68700941 | ||
| 131 | Acetylation | PYPYATLKKWISLTN CCCHHHHHHHHHHHH | 25953088 | ||
| 131 | Ubiquitination | PYPYATLKKWISLTN CCCHHHHHHHHHHHH | 21906983 | ||
| 132 | Ubiquitination | YPYATLKKWISLTNF CCHHHHHHHHHHHHH | 23503661 | ||
| 159 | Phosphorylation | NRQICAFSDVLPVLS CCEECCCCCHHHHHC | 46177329 | ||
| 166 | Phosphorylation | SDVLPVLSMKHTKDR CCHHHHHCCCCCCCC | 24667141 | ||
| 168 | Ubiquitination | VLPVLSMKHTKDRVG HHHHHCCCCCCCCCC | 32015554 | ||
| 186 | Ubiquitination | PRCGIECKSYQEGLA CCCCCCCCCHHHHHH | 21963094 | ||
| 188 | Phosphorylation | CGIECKSYQEGLARL CCCCCCCHHHHHHCC | 1948273 | ||
| 199 | Ubiquitination | LARLPEMKPRAGTEI HHCCCCCCCCCCCEE | 32142685 | ||
| 215 | Sulfoxidation | FSELPTQMFPEGATP HHCCCCCCCCCCCCH | 21406390 | ||
| 284 | Phosphorylation | LLNLLCRSEAAMMKH HHHHHHHHHHHHHHH | 46177335 | ||
| 347 | Ubiquitination | VDATLRKKAEKFQAH HHHHHHHHHHHHHHH | 29967540 | ||
| 350 | Ubiquitination | TLRKKAEKFQAHLTK HHHHHHHHHHHHHHH | 29967540 | ||
| 357 | Ubiquitination | KFQAHLTKKFRWDFA HHHHHHHHHCCCCCC | 29967540 | ||
| 357 | 2-Hydroxyisobutyrylation | KFQAHLTKKFRWDFA HHHHHHHHHCCCCCC | - | ||
| 358 | Ubiquitination | FQAHLTKKFRWDFAA HHHHHHHHCCCCCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AAR2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AAR2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AAR2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
