dbPTM

AAD14_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AAD14_YEAST
UniProt AC	P42884
Protein Name	Putative aryl-alcohol dehydrogenase AAD14
Gene Name	AAD14
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	376
Subcellular Localization
Protein Description
Protein Sequence	MTDLFKPLPEPPTELGRLRVLSKTAGIRVSPLILGGASIGDAWSGFMGSMNKEQAFELLDAFYEAGGNCIDTANSYQNEESEIWIGEWMASRKLRDQIVIATKFTGDYKKYEVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHWWDYMSSIEEVMDSLHILVQQGKVLYLGVSDTPAWVVSAANYYATSHGKTPFSVYQGKWNVLNRDFERDIIPMARHFGMALAPWDVMGGGRFQSKKAMEERKKNGEGLRTFVGGPEQTELEVKISEALTKIAEEHGTESVTAIAIAYVRSKAKNVFPLIGGRKIEHLKQNIEALSIKLTPEQIEYLESIVPFDVGFPKSLIGDDPAVTKKLSPLTSMSARIAFDN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
118	Phosphorylation	YEVGGGKSANYCGNH EEECCCCCCCCCCCC	25.64	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AAD14_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AAD14_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AAD14_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AAD14_YEAST	AAD14	physical	11283351
ATM_YEAST	TEL1	genetic	27708008
TPS1_YEAST	TPS1	genetic	27708008
GSM1_YEAST	GSM1	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
UTP9_YEAST	UTP9	genetic	27708008
MOB1_YEAST	MOB1	genetic	27708008
NU192_YEAST	NUP192	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
SED5_YEAST	SED5	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
ROT1_YEAST	ROT1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
SEC63_YEAST	SEC63	genetic	27708008
SEC23_YEAST	SEC23	genetic	27708008
IST2_YEAST	IST2	genetic	27708008
YCP7_YEAST	YCR007C	genetic	27708008
ELO2_YEAST	ELO2	genetic	27708008
MTU1_YEAST	SLM3	genetic	27708008
RLA1_YEAST	RPP1A	genetic	27708008
SWF1_YEAST	SWF1	genetic	27708008
BCS1_YEAST	BCS1	genetic	27708008
YFB2_YEAST	YFL012W	genetic	27708008
QCR9_YEAST	QCR9	genetic	27708008
PHB2_YEAST	PHB2	genetic	27708008
SPG1_YEAST	SPG1	genetic	27708008
COX23_YEAST	COX23	genetic	27708008
FLX1_YEAST	FLX1	genetic	27708008
TPM2_YEAST	TPM2	genetic	27708008
CYP7_YEAST	CPR7	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
MDM35_YEAST	MDM35	genetic	27708008
LST4_YEAST	LST4	genetic	27708008
DCOR_YEAST	SPE1	genetic	27708008
MKS1_YEAST	MKS1	genetic	27708008
HMI1_YEAST	HMI1	genetic	27708008
MNE1_YEAST	MNE1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AAD14_YEAST

Related Literatures of Post-Translational Modification