2B1F_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: 2B1F_HUMAN
• UniProt AC: P01911
• Protein Name: HLA class II histocompatibility antigen, DRB1-15 beta chain
• Gene Name: HLA-DRB1
• Organism: Homo sapiens (Human).
• Sequence Length: 266
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein . Endoplasmic reticulum membrane ; Single-pass type I membrane protein . Golgi apparatus, trans-Golgi network membrane ; Single-pass type I membrane protein . Endosome membrane ; Single-pass type I membr
• Protein Description: Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route, where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules, and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments, exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides, autophagosomes constitutively fuse with MHC class II loading compartments. In addition to APCs, other cells of the gastrointestinal tract, such as epithelial cells, express MHC class II molecules and CD74 and act as APCs, which is an unusual trait of the GI tract. To produce a MHC class II molecule that presents an antigen, three MHC class II molecules (heterodimers of an alpha and a beta chain) associate with a CD74 trimer in the ER to form a heterononamer. Soon after the entry of this complex into the endosomal/lysosomal system where antigen processing occurs, CD74 undergoes a sequential degradation by various proteases, including CTSS and CTSL, leaving a small fragment termed CLIP (class-II-associated invariant chain peptide). The removal of CLIP is facilitated by HLA-DM via direct binding to the alpha-beta-CLIP complex so that CLIP is released. HLA-DM stabilizes MHC class II molecules until primary high affinity antigenic peptides are bound. The MHC II molecule bound to a peptide is then transported to the cell membrane surface. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Primary dendritic cells (DCs) also to express HLA-DO. Lysosomal microenvironment has been implicated in the regulation of antigen loading into MHC II molecules, increased acidification produces increased proteolysis and efficient peptide loading..
• Protein Sequence: MVCLKLPGGSCMTALTVTLMVLSSPLALSGDTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of 2B1F_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of 2B1F_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of 2B1F_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of 2B1F_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RO52_HUMAN	TRIM21	physical	18022694
TERA_HUMAN	VCP	physical	18022694
KPYM_HUMAN	PKM	physical	20458337
HS90A_HUMAN	HSP90AA1	physical	20458337
HSP7C_HUMAN	HSPA8	physical	20458337
ANX11_HUMAN	ANXA11	physical	20458337
HS90B_HUMAN	HSP90AB1	physical	20458337
AT1B1_HUMAN	ATP1B1	physical	20458337
1433E_HUMAN	YWHAE	physical	20458337
CD20_HUMAN	MS4A1	physical	20458337
MAGA3_HUMAN	MAGEA3	physical	12393675
2B1F_HUMAN	HLA-DRB1	physical	26186194
2B13_HUMAN	HLA-DRB1	physical	26186194
2B1G_HUMAN	HLA-DRB1	physical	26186194
DRB5_HUMAN	HLA-DRB5	physical	26186194
PHOP1_HUMAN	PHOSPHO1	physical	26186194
DRB5_HUMAN	HLA-DRB5	physical	28514442
2B1F_HUMAN	HLA-DRB1	physical	28514442
2B13_HUMAN	HLA-DRB1	physical	28514442
2B1G_HUMAN	HLA-DRB1	physical	28514442
EMC6_HUMAN	EMC6	physical	28514442
CNNM1_HUMAN	CNNM1	physical	28514442
ERG1_HUMAN	SQLE	physical	28514442
E2AK3_HUMAN	EIF2AK3	physical	28514442
RN149_HUMAN	RNF149	physical	28514442
PDE3B_HUMAN	PDE3B	physical	28514442
ITA6_HUMAN	ITGA6	physical	28514442
K319L_HUMAN	KIAA0319L	physical	28514442
SEM4F_HUMAN	SEMA4F	physical	28514442
BT2A2_HUMAN	BTN2A2	physical	28514442
CNEP1_HUMAN	CTDNEP1	physical	28514442
IMPA3_HUMAN	IMPAD1	physical	28514442

Drug and Disease Associations

• Kegg Disease
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.