CNEP1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNEP1_HUMAN
• UniProt AC: O95476
• Protein Name: CTD nuclear envelope phosphatase 1
• Gene Name: CTDNEP1
• Organism: Homo sapiens (Human).
• Sequence Length: 244
• Subcellular Localization: Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.
• Protein Description: Serine/threonine protein phosphatase forming with CNEP1R1 an active phosphatase complex that dephosphorylates and may activate LPIN1 and LPIN2. LPIN1 and LPIN2 are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol and control the metabolism of fatty acids at different levels. May indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be required for proper nuclear membrane morphology and/or dynamics. May also indirectly regulate the production of lipid droplets and triacylglycerol. May antagonize BMP signaling..
• Protein Sequence: MMRTQCLLGLRTFVAFAAKLWSFFIYLLRRQIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDGVLRPTVRPGTPPDFILKVVIDKHPVRFFVHKRPHVDFFLEVVSQWYELVVFTASMEIYGSAVADKLDNSRSILKRRYYRQHCTLELGSYIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLSRNLHQHRLW

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
43	Phosphorylation	IQYQTVRYDILPLSP HCEEEEEEEECCCCC	11.73	-
49	Phosphorylation	RYDILPLSPVSRNRL EEEECCCCCCCHHHH	22.70	30266825
52	Phosphorylation	ILPLSPVSRNRLAQV ECCCCCCCHHHHHHH	27.50	30266825
60	Ubiquitination	RNRLAQVKRKILVLD HHHHHHHCCEEEEEE	35.57	27667366
101	Ubiquitination	ILKVVIDKHPVRFFV EEEEEECCCCEEEEE	38.39	33845483
148	Phosphorylation	VADKLDNSRSILKRR HHHHCCCCCHHHHHH	27.37	24702127
150	Phosphorylation	DKLDNSRSILKRRYY HHCCCCCHHHHHHHH	31.90	24719451
231	Methylation	LRFTADVRSVLSRNL HHHHHHHHHHHHHCC	22.92	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CNEP1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNEP1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNEP1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
AT2A2_HUMAN	ATP2A2	physical	27880917
HAX1_HUMAN	HAX1	physical	27880917
TBB6_HUMAN	TUBB6	physical	27880917
ACBD5_HUMAN	ACBD5	physical	27880917
ITPR1_HUMAN	ITPR1	physical	27880917
ITPR2_HUMAN	ITPR2	physical	27880917
NCPR_HUMAN	POR	physical	27880917
ITPR3_HUMAN	ITPR3	physical	27880917
VP13A_HUMAN	VPS13A	physical	27880917
SUN2_HUMAN	SUN2	physical	27880917
MAN1_HUMAN	LEMD3	physical	27880917
SENP2_HUMAN	SENP2	physical	27880917
TRI13_HUMAN	TRIM13	physical	27880917
ABCD3_HUMAN	ABCD3	physical	27880917
VRK2_HUMAN	VRK2	physical	27880917
OCAD1_HUMAN	OCIAD1	physical	27880917
SYNE2_HUMAN	SYNE2	physical	27880917
VAS1_HUMAN	ATP6AP1	physical	27880917
PGRC2_HUMAN	PGRMC2	physical	27880917
EMC3_HUMAN	EMC3	physical	27880917
NSMA3_HUMAN	SMPD4	physical	27880917
VEZA_HUMAN	VEZT	physical	27880917
AAAS_HUMAN	AAAS	physical	27880917
GRM1A_HUMAN	GRAMD1A	physical	27880917
PDZD8_HUMAN	PDZD8	physical	27880917
NDC1_HUMAN	NDC1	physical	27880917
SUN1_HUMAN	SUN1	physical	27880917
AL3A2_HUMAN	ALDH3A2	physical	27880917
PTN1_HUMAN	PTPN1	physical	27880917
EMC1_HUMAN	EMC1	physical	27880917
CCD47_HUMAN	CCDC47	physical	27880917

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.