SUMO1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SUMO1_ARATH
• UniProt AC: P55852
• Protein Name: Small ubiquitin-related modifier 1
• Gene Name: SUMO1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 100
• Subcellular Localization: Nucleus. Cytoplasm.
• Protein Description: Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1. Involved in the regulation of the heat stress transcription factor HSFA2 in acquired thermotolerance..
• Protein Sequence: MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSANQEEDK ------CCCCCCCCC	35.61	27643528
23	Sumoylation	AHINLKVKGQDGNEV EEEEEEEECCCCCEE	49.63	-
42	Sumoylation	KRSTQLKKLMNAYCD ECHHHHHHHHHHHHC	62.65	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SUMO1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SUMO1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SUMO1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HSFA2_ARATH	HSFA2	physical	20521085
NAC81_ARATH	ATAF2	physical	20813957
ARID3_ARATH	AT2G17410	physical	20813957
DEAH5_ARATH	AT3G26560	physical	20813957
CP19A_ARATH	ROC3	physical	20813957
SCE1_ARATH	SCE1	physical	20813957
SEUSS_ARATH	SEU	physical	20813957
SIZ1_ARATH	SIZ1	physical	20813957
SUVR2_ARATH	SUVR2	physical	20813957
TIC_ARATH	TIC	physical	20813957
WRKY3_ARATH	WRKY3	physical	20813957
WRKY4_ARATH	WRKY4	physical	20813957
MCM3_ARATH	MCM3	physical	21607647
UBA2A_ARATH	UBA2A	physical	21607647
SMC1_ARATH	TTN8	physical	21607647
C3H35_ARATH	AT3G08505	physical	21607647
CHR25_ARATH	RAD54	physical	21607647
IF4G_ARATH	EIF4G	physical	21607647
PLCD8_ARATH	PLC8	physical	21607647
EFTM_ARATH	AT4G02930	physical	21607647
PS10B_ARATH	AT1G45000	physical	21607647
MASY_ARATH	MLS	physical	21607647
BGL23_ARATH	PYK10	physical	21607647
GLYM1_ARATH	SHM1	physical	21607647
GCST_ARATH	AT1G11860	physical	21607647
BXL1_ARATH	BXL1	physical	21607647
G3PA1_ARATH	GAPA	physical	21607647
G3PC2_ARATH	GAPC2	physical	21607647
PANB1_ARATH	KPHMT1	physical	21607647
AAT5_ARATH	ASP5	physical	21607647
DLDH1_ARATH	mtLPD1	physical	21607647
NIA1_ARATH	NIA1	physical	21772271
SCE1_ARATH	SCE1	physical	24255109
SIZ1_ARATH	SIZ1	physical	24255109
SINL4_ARATH	AT1G66650	physical	24255109
ASHH2_ARATH	EFS	physical	24255109
JMJ16_ARATH	PKDM7D	physical	24255109
CMT2_ARATH	CMT2	physical	24255109
DME_ARATH	DME	physical	24255109
EXO1_ARATH	AT1G29630	physical	24255109
MOM1_ARATH	MOM	physical	24255109
CDF2_ARATH	CDF2	physical	24255109
AML5_ARATH	ML5	physical	19151129
UBA2A_ARATH	UBA2A	physical	19151129
LRP6B_ARATH	AT2G43970	physical	19151129
IF4G_ARATH	EIF4G	physical	19151129
TAF7_ARATH	TAF7	physical	19151129
NAP1B_ARATH	NAP1;2	physical	19151129
CDF2_ARATH	CDF2	physical	19151129
TAF4B_ARATH	TAF4	physical	19151129
FY_ARATH	FY	physical	19151129
LTI65_ARATH	LTI65	physical	19151129
ICE1_ARATH	ICE1	physical	17416732

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.