dbPTM

FY_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FY_ARATH
UniProt AC	Q6NLV4
Protein Name	Flowering time control protein FY
Gene Name	FY
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	647
Subcellular Localization	Nucleus .
Protein Description	Plays a role in the regulation of flowering time in the autonomous flowering pathway by decreasing FLOWERING LOCUS C mRNA levels. Required for the negative autoregulation of FCA expression. Acts probably as an RNA 3' end-processing factor. Required for growth and development in plants..
Protein Sequence	MYAGGDMHRGSQMPQPPMMRQSSASSTNINPDYHHPSGPFDPNVDSFGAKRMRKHTQRRAVDYTSTVVRYIQARTWQRDSRDRTTLQPTPAAAVDMLPTVAYSDNPSTSFAAKFVHASLNKNRCSINRVLWTPSGRRLITGSQSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSHNENYMVSGDDGGTLKYWQNNMNNVKANKTAHKESIRDLSFCKTDLKFCSCSDDTTVKVWDFTKCVDESSLTGHGWDVKSVDWHPTKSLLVSGGKDQLVKLWDTRSGRELCSLHGHKNIVLSVKWNQNGNWLLTASKDQIIKLYDIRTMKELQSFRGHTKDVTSLAWHPCHEEYFVSGSSDGSICHWIVGHENPQIEIPNAHDNSVWDLAWHPIGYLLCSGSNDHTTKFWCRNRPADNPRDVLMQNQGYNEQGFGRQPDNFQPSEASPIPGAFVPGLTRNEGTIPGIGIAMPFDASSQGDHKQPLPGSMALGAPPLPPGPHPSLLGSGQQQGYQQQQQHQGHPQQMLPMPNMPHHQLPPSSHMPLHPHHLPRPMQMPPHGHMPPPSMPMSHQMPGSMGMQGGMNPQMSQSHFMGAPSGVFQGQPNSGGPQMYPQGRGGFNRPQMIPGYNNPFQQQQQPPLPPGPPPNNNQQHQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FY_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FY_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FY_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FY_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CPSF2_ARATH	CPSF100	physical	19748916
CPSF1_ARATH	CPSF160	physical	19748916
CPS3B_ARATH	CPSF73-II	physical	19748916
FY_ARATH	FY	physical	19748916
CPSF2_ARATH	CPSF100	physical	19439664
CPSF1_ARATH	CPSF160	physical	19439664

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FY_ARATH

Related Literatures of Post-Translational Modification