UniProt ID | HSFA2_ARATH | |
---|---|---|
UniProt AC | O80982 | |
Protein Name | Heat stress transcription factor A-2 | |
Gene Name | HSFA2 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 345 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress responses. Seems to be involved in other environmental stress responses. Activates ascorbate peroxidase 2 (APX2) in addition to several heat shock protein (HSPs).. | |
Protein Sequence | MEELKVEMEEETVTFTGSVAASSSVGSSSSPRPMEGLNETGPPPFLTKTYEMVEDPATDTVVSWSNGRNSFVVWDSHKFSTTLLPRYFKHSNFSSFIRQLNTYGFRKIDPDRWEFANEGFLAGQKHLLKNIKRRRNMGLQNVNQQGSGMSCVEVGQYGFDGEVERLKRDHGVLVAEVVRLRQQQHSSKSQVAAMEQRLLVTEKRQQQMMTFLAKALNNPNFVQQFAVMSKEKKSLFGLDVGRKRRLTSTPSLGTMEENLLHDQEFDRMKDDMEMLFAAAIDDEANNSMPTKEEQCLEAMNVMMRDGNLEAALDVKVEDLVGSPLDWDSQDLHDMVDQMGFLGSEP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSFA2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
315 | K | Sumoylation |
| 20521085 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSFA2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
HSFA2_ARATH | HSFA2 | physical | 20458611 | |
HFA1A_ARATH | HSF1 | physical | 20458611 | |
HFA1B_ARATH | HSF3 | physical | 20458611 | |
HS901_ARATH | HSP90.1 | physical | 19366428 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Sumoylation | |
Reference | PubMed |
"Sumoylation of Arabidopsis heat shock factor A2 (HsfA2) modifies itsactivity during acquired thermotholerance."; Cohen-Peer R., Schuster S., Meiri D., Breiman A., Avni A.; Plant Mol. Biol. 74:33-45(2010). Cited for: INTERACTION WITH SUMO1, SUBCELLULAR LOCATION, SUMOYLATION AT LYS-315,DISRUPTION PHENOTYPE, AND MUTAGENESIS OF LYS-5; LYS-167; LYS-269 ANDLYS-315. |