dbPTM

PLCD8_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PLCD8_ARATH
UniProt AC	Q9STZ3
Protein Name	Phosphoinositide phospholipase C 8
Gene Name	PLC8
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	531
Subcellular Localization	Cell membrane Peripheral membrane protein.
Protein Description	The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes..
Protein Sequence	MLVTRRWESHPANSPDLILQFFGNEFHGYGDDMPETLRRLTELLGYEKEEDGAGMNAAKKIAAELNRRKDDIPAFRRLRCLELDQLNEFLFSTKLNPPIGDQVHHDMHAPLSHYFIHTSLNSYFTGNVFGKYSILPIIEALEQGVRVVELDLWPDGRGSICVRPSWNFEKPLKLQECLDSIKEHAFTKCTYPLIITFKDGLKPELQSKATQMIQQTFNHMVYHHDPHSLEVFPSPQQLRNKILISRRPPKELLYANDDDGKVGVRNGVEIRQHPADPNYQSLVSFHVVEPRGMLQNVLTGKANKIQRPGWYETDIISFTQKRFLRTRPQRKLLIYAPYKPQRAWMHGAQLIALSRKEEKEKLWLMQGMFRANGGCGYVKKPDFLLNAGPSGVFYPTVNPVVVKILKVKIYMGDGWIVDFKKRIGRLSKPDLYVRISIAGVPHDENIMKTTVKNNEWTPTWGEEFTFPLTYPDLALISFEVYDYEVSTADAFCGQTCLPVSELIEGIRAVPLYDERGKACSSTMLLTRFKWS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PLCD8_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PLCD8_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PLCD8_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PLCD8_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PLCD8_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PLCD8_ARATH

Related Literatures of Post-Translational Modification