UniProt ID | NDUF8_HUMAN | |
---|---|---|
UniProt AC | A1L188 | |
Protein Name | NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 8 {ECO:0000312|HGNC:HGNC:33551} | |
Gene Name | NDUFAF8 {ECO:0000312|HGNC:HGNC:33551} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 74 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Involved in the assembly of mitochondrial NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1). [PubMed: 27499296 Required to stabilize NDUFAF5] | |
Protein Sequence | MSANGAVWGRVRSRLRAFPERLAACGAEAAAYGRCVQASTAPGGRLSKDFCAREFEALRSCFAAAAKKTLEGGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Methylation | ANGAVWGRVRSRLRA CCCHHHHHHHHHHHH | 115482203 | ||
13 | Phosphorylation | AVWGRVRSRLRAFPE HHHHHHHHHHHHCHH | 24719451 | ||
32 | Phosphorylation | CGAEAAAYGRCVQAS HCHHHHHHCHHHHCC | 24719451 | ||
39 | Phosphorylation | YGRCVQASTAPGGRL HCHHHHCCCCCCCCC | 23927012 | ||
40 | Phosphorylation | GRCVQASTAPGGRLS CHHHHCCCCCCCCCC | 23927012 | ||
47 | Phosphorylation | TAPGGRLSKDFCARE CCCCCCCCHHHHHHH | 23927012 | ||
48 | Ubiquitination | APGGRLSKDFCAREF CCCCCCCHHHHHHHH | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NDUF8_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NDUF8_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NDUF8_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...