RM54_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RM54_HUMAN
• UniProt AC: Q6P161
• Protein Name: 39S ribosomal protein L54, mitochondrial
• Gene Name: MRPL54
• Organism: Homo sapiens (Human).
• Sequence Length: 138
• Subcellular Localization: Mitochondrion .
• Protein Sequence: MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MATKRLFGAT -----CCCCCCCCCC	18.52	24719451
62	Glutathionylation	ALKDPDVCTDPVQLT HHCCCCCCCCCHHHE	4.69	22555962
106	Phosphorylation	MNLGPPKTLEELDPE CCCCCCCCHHHHCHH	45.21	27966365
115	Methylation	EELDPESREYWRRLR HHHCHHHHHHHHHHH	39.09	115483797

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RM54_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RM54_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RM54_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RT07_HUMAN	MRPS7	physical	22939629

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.