MGN_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: MGN_MOUSE
• UniProt AC: P61327
• Protein Name: Protein mago nashi homolog
• Gene Name: Magoh
• Organism: Mus musculus (Mouse).
• Sequence Length: 146
• Subcellular Localization: Nucleus. Nucleus speckle. Cytoplasm. Detected in granule-like structures in the dendroplasm. Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. Colocalizes with the core EJC, ALYREF/THOC4, NXF1 and UAP56 in the nucleus
• Protein Description: Core component of the splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junctions on mRNAs. The EJC is a dynamic structure consisting of core proteins and several peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. The EJC marks the position of the exon-exon junction in the mature mRNA for the gene expression machinery and the core components remain bound to spliced mRNAs throughout all stages of mRNA metabolism thereby influencing downstream processes including nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). The MAGOH-RBM8A heterodimer inhibits the ATPase activity of EIF4A3, thereby trapping the ATP-bound EJC core onto spliced mRNA in a stable conformation. The MAGOH-RBM8A heterodimer interacts with the EJC key regulator PYM1 leading to EJC disassembly in the cytoplasm and translation enhancement of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex. Involved in the splicing modulation of BCL2L1/Bcl-X (and probably other apoptotic genes); specifically inhibits formation of proapoptotic isoforms; the function is different from the established EJC assembly (By similarity)..
• Protein Sequence: MESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MESDFYLR -------CCCCEEEE	11.39	-
16	Acetylation	YYVGHKGKFGHEFLE EECCCCCCCCCEEEE	53.64	23806337
38	Phosphorylation	KLRYANNSNYKNDVM CEEECCCCCCCCCEE	41.15	25367039
40	Phosphorylation	RYANNSNYKNDVMIR EECCCCCCCCCEEEE	15.81	25367039
41	Ubiquitination	YANNSNYKNDVMIRK ECCCCCCCCCEEEEH	51.42	22790023
41	Acetylation	YANNSNYKNDVMIRK ECCCCCCCCCEEEEH	51.42	23806337
106	Phosphorylation	FTTSKIGSLIDVNQS EECCCCCCEEECCCC	26.14	22942356
114	Ubiquitination	LIDVNQSKDPEGLRV EEECCCCCCCCHHHH	68.49	22790023
114	Acetylation	LIDVNQSKDPEGLRV EEECCCCCCCCHHHH	68.49	23236377

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of MGN_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of MGN_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of MGN_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DNM3B_HUMAN	DNMT3B	physical	26496610
GOGA4_HUMAN	GOLGA4	physical	26496610
ITA1_HUMAN	ITGA1	physical	26496610
M3K4_HUMAN	MAP3K4	physical	26496610
6PGD_HUMAN	PGD	physical	26496610
ZN207_HUMAN	ZNF207	physical	26496610
KIF3B_HUMAN	KIF3B	physical	26496610
CROCC_HUMAN	CROCC	physical	26496610
RBM8A_HUMAN	RBM8A	physical	26496610
APBP2_HUMAN	APPBP2	physical	26496610
HPS5_HUMAN	HPS5	physical	26496610
HS74L_HUMAN	HSPA4L	physical	26496610
ZN609_HUMAN	ZNF609	physical	26496610
KI26A_HUMAN	KIF26A	physical	26496610
MGN2_HUMAN	MAGOHB	physical	26496610
FEM1A_HUMAN	FEM1A	physical	26496610
KI16B_HUMAN	KIF16B	physical	26496610
KIF17_HUMAN	KIF17	physical	26496610
RBSK_HUMAN	RBKS	physical	26496610
S35E1_HUMAN	SLC35E1	physical	26496610
TPC13_HUMAN	TRAPPC13	physical	26496610
PYM1_HUMAN	WIBG	physical	26496610
SNX29_HUMAN	SNX29	physical	26496610
TGS1_HUMAN	TGS1	physical	26496610
IPIL2_HUMAN	ITPRIPL2	physical	26496610

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.