UniProt ID | EFMT3_HUMAN | |
---|---|---|
UniProt AC | Q96AZ1 | |
Protein Name | EEF1A lysine methyltransferase 3 {ECO:0000312|HGNC:HGNC:24936} | |
Gene Name | EEF1AKMT3 {ECO:0000312|HGNC:HGNC:24936} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 226 | |
Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton, microtubule organizing center, centrosome . | |
Protein Description | Protein-lysine methyltransferase that selectively methylates EEF1A1 and EEF1A2 at 'Lys-165' in an aminoacyl-tRNA and GTP-dependent manner. EEF1A1 methylation by EEF1AKMT3 is dynamic as well as inducible by stress conditions, such as ER-stress, and plays a regulatory role on mRNA translation.. | |
Protein Sequence | MADPGPDPESESESVFPREVGLFADSYSEKSQFCFCGHVLTITQNFGSRLGVAARVWDAALSLCNYFESQNVDFRGKKVIELGAGTGIVGILAALQGGDVTITDLPLALEQIQGNVQANVPAGGQAQVRALSWGIDHHVFPANYDLVLGADIVYLEPTFPLLLGTLQHLCRPHGTIYLASKMRKEHGTESFFQHLLPQHFQLELAQRDEDENVNIYRARHREPRPA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Phosphorylation | DPGPDPESESESVFP CCCCCCCCCCCCCCC | 25627689 | ||
12 | Phosphorylation | GPDPESESESVFPRE CCCCCCCCCCCCCHH | 25627689 | ||
14 | Phosphorylation | DPESESESVFPREVG CCCCCCCCCCCHHHC | 29255136 | ||
177 | Phosphorylation | CRPHGTIYLASKMRK HCCCCCEEEEEHHHH | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EFMT3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EFMT3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EFMT3_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...