| UniProt ID | CMC4_YEAST | |
|---|---|---|
| UniProt AC | Q3E7A9 | |
| Protein Name | Cx9C motif-containing protein 4, mitochondrial | |
| Gene Name | CMC4 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 73 | |
| Subcellular Localization | Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. | |
| Protein Description | ||
| Protein Sequence | MSNPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCCPLPSLLELKMKQRKLTPGDS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of CMC4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CMC4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CMC4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CMC4_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEC7_YEAST | SEC7 | genetic | 27708008 | |
| VAM7_YEAST | VAM7 | genetic | 27708008 | |
| ENV10_YEAST | ENV10 | genetic | 27708008 | |
| SC61G_YEAST | SSS1 | genetic | 27708008 | |
| SLU7_YEAST | SLU7 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| SYMC_YEAST | MES1 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| DCP2_YEAST | DCP2 | genetic | 27708008 | |
| GRPE_YEAST | MGE1 | genetic | 27708008 | |
| SYA_YEAST | ALA1 | genetic | 27708008 | |
| SEC62_YEAST | SEC62 | genetic | 27708008 | |
| ATC3_YEAST | DRS2 | genetic | 27708008 | |
| ODPB_YEAST | PDB1 | genetic | 27708008 | |
| THI2_YEAST | THI2 | genetic | 27708008 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| TRM82_YEAST | TRM82 | genetic | 27708008 | |
| GNTK_YEAST | YDR248C | genetic | 27708008 | |
| SLX8_YEAST | SLX8 | genetic | 27708008 | |
| SDHX_YEAST | YJL045W | genetic | 27708008 | |
| SIP4_YEAST | SIP4 | genetic | 27708008 | |
| NKP2_YEAST | NKP2 | genetic | 27708008 | |
| ORM2_YEAST | ORM2 | genetic | 27708008 | |
| TBP6_YEAST | YTA6 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...