UniProt ID | CMC4_YEAST | |
---|---|---|
UniProt AC | Q3E7A9 | |
Protein Name | Cx9C motif-containing protein 4, mitochondrial | |
Gene Name | CMC4 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 73 | |
Subcellular Localization | Mitochondrion intermembrane space . Imported into the mitochondria via the mitochondrial MIA40-ERV1 machinery. | |
Protein Description | ||
Protein Sequence | MSNPCQKEACAIQDCLLSHQYDDAKCAKVIDQLYICCSKFYNDNGKDSRSPCCPLPSLLELKMKQRKLTPGDS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of CMC4_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CMC4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CMC4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CMC4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC7_YEAST | SEC7 | genetic | 27708008 | |
VAM7_YEAST | VAM7 | genetic | 27708008 | |
ENV10_YEAST | ENV10 | genetic | 27708008 | |
SC61G_YEAST | SSS1 | genetic | 27708008 | |
SLU7_YEAST | SLU7 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
SYMC_YEAST | MES1 | genetic | 27708008 | |
TAD3_YEAST | TAD3 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
DCP2_YEAST | DCP2 | genetic | 27708008 | |
GRPE_YEAST | MGE1 | genetic | 27708008 | |
SYA_YEAST | ALA1 | genetic | 27708008 | |
SEC62_YEAST | SEC62 | genetic | 27708008 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
ODPB_YEAST | PDB1 | genetic | 27708008 | |
THI2_YEAST | THI2 | genetic | 27708008 | |
BUD31_YEAST | BUD31 | genetic | 27708008 | |
TRM82_YEAST | TRM82 | genetic | 27708008 | |
GNTK_YEAST | YDR248C | genetic | 27708008 | |
SLX8_YEAST | SLX8 | genetic | 27708008 | |
SDHX_YEAST | YJL045W | genetic | 27708008 | |
SIP4_YEAST | SIP4 | genetic | 27708008 | |
NKP2_YEAST | NKP2 | genetic | 27708008 | |
ORM2_YEAST | ORM2 | genetic | 27708008 | |
TBP6_YEAST | YTA6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...