UniProt ID | CERK1_ARATH | |
---|---|---|
UniProt AC | A8R7E6 | |
Protein Name | Chitin elicitor receptor kinase 1 | |
Gene Name | CERK1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 617 | |
Subcellular Localization |
Cell membrane Single-pass membrane protein . |
|
Protein Description | Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity toward both biotic and abiotic stresses (e.g. tolerance to salinity, heavy-metal stresses, and Botrytis cinerea infection). Recognizes microbe-derived N-acetylglucosamine (NAG)-containing ligands. Involved in the resistance to pathogenic fungi Alternaria brassicicola and Erysiphe cichoracearum, probably by sensing microbe-associated molecular patterns (MAMP) and pathogen-associated molecular patterns (PAMP). Plays an essential role in detecting peptidoglycans (e.g. PGNs) and restricting bacterial growth. Target of the bacterial type III effector E3-ligase protein hopAB2/avrPtoB of Pseudomonas syringae pv. tomato DC3000 that mediates ubiquitination and subsequent proteolysis, thus blocking all defense responses by suppressing PAMP-triggered immunity (PTI). Mediates chitin-induced phosphorylation of PBL27. [PubMed: 24750441] | |
Protein Sequence | MKLKISLIAPILLLFSFFFAVESKCRTSCPLALASYYLENGTTLSVINQNLNSSIAPYDQINFDPILRYNSNIKDKDRIQMGSRVLVPFPCECQPGDFLGHNFSYSVRQEDTYERVAISNYANLTTMESLQARNPFPATNIPLSATLNVLVNCSCGDESVSKDFGLFVTYPLRPEDSLSSIARSSGVSADILQRYNPGVNFNSGNGIVYVPGRDPNGAFPPFKSSKQDGVGAGVIAGIVIGVIVALLLILFIVYYAYRKNKSKGDSFSSSIPLSTKADHASSTSLQSGGLGGAGVSPGIAAISVDKSVEFSLEELAKATDNFNLSFKIGQGGFGAVYYAELRGEKAAIKKMDMEASKQFLAELKVLTRVHHVNLVRLIGYCVEGSLFLVYEYVENGNLGQHLHGSGREPLPWTKRVQIALDSARGLEYIHEHTVPVYVHRDIKSANILIDQKFRAKVADFGLTKLTEVGGSATRGAMGTFGYMAPETVYGEVSAKVDVYAFGVVLYELISAKGAVVKMTEAVGEFRGLVGVFEESFKETDKEEALRKIIDPRLGDSYPFDSVYKMAELGKACTQENAQLRPSMRYIVVALSTLFSSTGNWDVGNFQNEDLVSLMSGR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
40 | N-linked_Glycosylation | LASYYLENGTTLSVI HHHHHHHCCCEEEEE | 22654057 | ||
52 | N-linked_Glycosylation | SVINQNLNSSIAPYD EEEECCCCCCCCCHH | 22654057 | ||
102 | N-linked_Glycosylation | PGDFLGHNFSYSVRQ CCCCCCCCCEEEEEC | 22654057 | ||
123 | N-linked_Glycosylation | VAISNYANLTTMESL EEEECCCCCCHHHHH | 22654057 | ||
152 | N-linked_Glycosylation | ATLNVLVNCSCGDES EEEEEEEECCCCCCC | 22654057 | ||
185 | Phosphorylation | LSSIARSSGVSADIL HHHHHHHCCCCHHHH | 29797451 | ||
266 | Phosphorylation | KNKSKGDSFSSSIPL HCCCCCCCCCCCCCC | 20610395 | ||
268 | Phosphorylation | KSKGDSFSSSIPLST CCCCCCCCCCCCCCC | 20610395 | ||
270 | Phosphorylation | KGDSFSSSIPLSTKA CCCCCCCCCCCCCCC | 22654057 | ||
274 | Phosphorylation | FSSSIPLSTKADHAS CCCCCCCCCCCCCCC | 20610395 | ||
281 | Phosphorylation | STKADHASSTSLQSG CCCCCCCCCCCCCCC | 27288362 | ||
282 | Phosphorylation | TKADHASSTSLQSGG CCCCCCCCCCCCCCC | 27288362 | ||
283 | Phosphorylation | KADHASSTSLQSGGL CCCCCCCCCCCCCCC | 27288362 | ||
284 | Phosphorylation | ADHASSTSLQSGGLG CCCCCCCCCCCCCCC | 27288362 | ||
287 | Phosphorylation | ASSTSLQSGGLGGAG CCCCCCCCCCCCCCC | 17317660 | ||
296 | Phosphorylation | GLGGAGVSPGIAAIS CCCCCCCCCCEEEEE | 27288362 | ||
303 | Phosphorylation | SPGIAAISVDKSVEF CCCEEEEECCCCCEE | 27288362 | ||
390 | Phosphorylation | EGSLFLVYEYVENGN HCEEEEEEEEHHCCC | - | ||
466 | Phosphorylation | DFGLTKLTEVGGSAT HCCCEEEEEECCCCC | 19880383 | ||
479 | Phosphorylation | ATRGAMGTFGYMAPE CCCCCCCCCCCCCCC | - | ||
519 | Phosphorylation | KGAVVKMTEAVGEFR CCCEEEHHHHHHHHH | 24750441 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CERK1_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CERK1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CERK1_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...