dbPTM

PP14_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PP14_ARATH
UniProt AC	P48484
Protein Name	Serine/threonine-protein phosphatase PP1 isozyme 4 {ECO:0000305}
Gene Name	TOPP4 {ECO:0000303\|PubMed:17368080}
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	321
Subcellular Localization	Nucleus . Cytoplasm . Localizes predominantly to the nucleus.
Protein Description	Serine/threonine-protein phosphatase that possesses phosphatase activity toward para-nitrophenyl phosphate (pNPP) in vitro. [PubMed: 21222654 Acts as positive regulator in the gibberellin (GA) signaling pathway to regulate plant growth and development. Promotes the GA-induced and proteasomal-dependent degradation of the DELLA proteins RGA and GAI by directly binding and dephosphorylating these proteins]
Protein Sequence	MATTTTTQGQQTAIDSAVLDDIIRRLTEVRLARPGKQVQLSEAEIKQLCTTARDIFLQQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPSANYLFLGDYVDRGKQSLETICLLLAYKIKYPGNFFLLRGNHECASINRIYGFYDECKRRFNVRVWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLDHLDEIRNLPRPTMIPDTGLLCDLLWSDPGKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQLVTVFSAPNYCGEFDNAGAMMSVDENLMCSFQILKPAEKKTKFMMSTKI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
2	Acetylation	------MATTTTTQG ------CCCEECCCH	17.41	22223895

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PP14_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PP14_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PP14_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GEML3_ARATH	AT4G40100	physical	22585556
GEM_ARATH	GEM	physical	22585556
PINI_ARATH	PIN1	physical	25560878
RGA_ARATH	RGA1	physical	25010794
GAI_ARATH	GAI	physical	25010794

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PP14_ARATH

Related Literatures of Post-Translational Modification