UniProt ID | PP14_ARATH | |
---|---|---|
UniProt AC | P48484 | |
Protein Name | Serine/threonine-protein phosphatase PP1 isozyme 4 {ECO:0000305} | |
Gene Name | TOPP4 {ECO:0000303|PubMed:17368080} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 321 | |
Subcellular Localization | Nucleus . Cytoplasm . Localizes predominantly to the nucleus. | |
Protein Description | Serine/threonine-protein phosphatase that possesses phosphatase activity toward para-nitrophenyl phosphate (pNPP) in vitro. [PubMed: 21222654 Acts as positive regulator in the gibberellin (GA) signaling pathway to regulate plant growth and development. Promotes the GA-induced and proteasomal-dependent degradation of the DELLA proteins RGA and GAI by directly binding and dephosphorylating these proteins] | |
Protein Sequence | MATTTTTQGQQTAIDSAVLDDIIRRLTEVRLARPGKQVQLSEAEIKQLCTTARDIFLQQPNLLELEAPIKICGDIHGQYSDLLRLFEYGGFPPSANYLFLGDYVDRGKQSLETICLLLAYKIKYPGNFFLLRGNHECASINRIYGFYDECKRRFNVRVWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLDHLDEIRNLPRPTMIPDTGLLCDLLWSDPGKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQLVTVFSAPNYCGEFDNAGAMMSVDENLMCSFQILKPAEKKTKFMMSTKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MATTTTTQG ------CCCEECCCH | 17.41 | 22223895 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PP14_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PP14_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PP14_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
GEML3_ARATH | AT4G40100 | physical | 22585556 | |
GEM_ARATH | GEM | physical | 22585556 | |
PINI_ARATH | PIN1 | physical | 25560878 | |
RGA_ARATH | RGA1 | physical | 25010794 | |
GAI_ARATH | GAI | physical | 25010794 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...