| UniProt ID | GEM_ARATH | |
|---|---|---|
| UniProt AC | Q8S8F8 | |
| Protein Name | GLABRA2 expression modulator | |
| Gene Name | GEM | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 299 | |
| Subcellular Localization | ||
| Protein Description | Involved in the spatial control of cell division, patterning and differentiation of Arabidopsis root epidermal cells. Could be part of a complex that negatively modulates GLABRA2 and CAPRICE expression via the maintenance of a repressor histone H3 epigenetics status of the GL2 and CPC promoters.. | |
| Protein Sequence | MEPPKGDTVVKTEVPVKDPSLSVVDSKTKGVEDANTEIALSDEVEIETKGSDSTPVKAPSRTSSGSKKSVHWSPELVSGSQEPDQKAASSSSAGSNPYIARSPAETSDASLKDTMETVKGVLGRWGKRVAEAAKKTESLAGNTWQHLRTAPSFADAAMGRIAQSTKVFAEGGYEKIFRQTFETDPEEQLLNSFACYLSTSAGPVMGVLYISSAKLAYCSDNPLSYKNGDQTEWSYYKVVIPLHQLKAVNPSASIVNPAEKYIQVISVDNHEFWFMGFLNYDGAVTSLQDSLQAGALRSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 26 | Phosphorylation | PSLSVVDSKTKGVED CCCEEEECCCCCCCC | 30.52 | 23111157 | |
| 60 | Phosphorylation | STPVKAPSRTSSGSK CCCEECCCCCCCCCC | 53.72 | 25561503 | |
| 69 | Phosphorylation | TSSGSKKSVHWSPEL CCCCCCCCEECCHHH | 23.97 | 19880383 | |
| 73 | Phosphorylation | SKKSVHWSPELVSGS CCCCEECCHHHCCCC | 8.13 | 19880383 | |
| 117 | Phosphorylation | SLKDTMETVKGVLGR CHHHHHHHHHHHHHH | 19.39 | 19880383 | |
| 152 | Phosphorylation | QHLRTAPSFADAAMG HHHHHCHHHHHHHHH | 30.51 | 25561503 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GEM_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GEM_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GEM_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of GEM_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
