APX1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APX1_ARATH
• UniProt AC: Q05431
• Protein Name: L-ascorbate peroxidase 1, cytosolic
• Gene Name: APX1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 250
• Subcellular Localization: Cytoplasm.
• Protein Description: Plays a key role in hydrogen peroxide removal. Constitutes a central component of the reactive oxygen gene network..
• Protein Sequence: MTKNYPTVSEDYKKAVEKCRRKLRGLIAEKNCAPIMVRLAWHSAGTFDCQSRTGGPFGTMRFDAEQAHGANSGIHIALRLLDPIREQFPTISFADFHQLAGVVAVEVTGGPDIPFHPGREDKPQPPPEGRLPDATKGCDHLRDVFAKQMGLSDKDIVALSGAHTLGRCHKDRSGFEGAWTSNPLIFDNSYFKELLSGEKEGLLQLVSDKALLDDPVFRPLVEKYAADEDAFFADYAEAHMKLSELGFADA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
32	S-nitrosylation	GLIAEKNCAPIMVRL HHHHHCCCHHHHHHH	7.64	22115780
149	Sulfoxidation	RDVFAKQMGLSDKDI HHHHHHHCCCCHHHH	6.01	25693801
196	Phosphorylation	SYFKELLSGEKEGLL HHHHHHHCCCCCHHH	58.49	22092075

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APX1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APX1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APX1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.