ACBP6_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACBP6_ARATH
• UniProt AC: P57752
• Protein Name: Acyl-CoA-binding domain-containing protein 6
• Gene Name: ACBP6
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 92
• Subcellular Localization: Cytoplasm .
• Protein Description: Binds medium- and long-chain acyl-CoA esters with very high affinity. May function as an intracellular carrier of acyl-CoA esters. Confers resistance to cold and freezing. Interacts with phosphatidylcholine and derivatives, but not phosphatidic acid and lysophosphatidylcholine. May be involved in phospholipid metabolism..
• Protein Sequence: MGLKEEFEEHAEKVNTLTELPSNEDLLILYGLYKQAKFGPVDTSRPGMFSMKERAKWDAWKAVEGKSSEEAMNDYITKVKQLLEVAASKAST

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Sulfoxidation	VDTSRPGMFSMKERA CCCCCCCCCCHHHHH	2.20	25693801
51	Sulfoxidation	SRPGMFSMKERAKWD CCCCCCCHHHHHCHH	3.41	25693801
72	Sulfoxidation	GKSSEEAMNDYITKV CCCHHHHHHHHHHHH	4.42	25693801
88	Phosphorylation	QLLEVAASKAST--- HHHHHHHHHCCC---	21.01	23776212
91	Phosphorylation	EVAASKAST------ HHHHHHCCC------	38.08	23776212
92	Phosphorylation	VAASKAST------- HHHHHCCC-------	47.71	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACBP6_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACBP6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACBP6_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of ACBP6_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.