UniProt ID | FNRL2_ARATH | |
---|---|---|
UniProt AC | Q8W493 | |
Protein Name | Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic | |
Gene Name | LFNR2 {ECO:0000303|Ref.5} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 369 | |
Subcellular Localization |
Plastid, chloroplast stroma . Plastid, chloroplast thylakoid membrane Peripheral membrane protein Stromal side . More abundant in the soluble fraction. The presence of LFNR1 is required for association with the thylakoid membrane. |
|
Protein Description | Plays a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.. | |
Protein Sequence | MATTMNAAVSLTSSNSSSFPATSCAIAPERIRFTKGAFYYKSNNVVTGKRVFSIKAQITTETDTPTPAKKVEKVSKKNEEGVIVNRYRPKEPYTGKCLLNTKITADDAPGETWHMVFSHQGEIPYREGQSVGVIADGIDKNGKPHKVRLYSIASSALGDLGNSETVSLCVKRLVYTNDQGETVKGVCSNFLCDLAPGSDVKLTGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTTSSLLYQEEFDKMKAKAPENFRVDYAISREQANDKGEKMYIQTRMAQYAAELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAANDGIDWFDYKKQLKKAEQWNVEVY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
87 | Phosphorylation | EGVIVNRYRPKEPYT CCEEEECCCCCCCCC | 26.51 | 25561503 | |
125 | Nitration | SHQGEIPYREGQSVG EECCCCCCCCCCEEE | 27.27 | - | |
175 | Phosphorylation | LCVKRLVYTNDQGET EEEEEEEEECCCCCC | 12.38 | 28295753 | |
176 | Phosphorylation | CVKRLVYTNDQGETV EEEEEEEECCCCCCE | 25.49 | 30291188 | |
182 | Phosphorylation | YTNDQGETVKGVCSN EECCCCCCEEEHHHH | 34.05 | 30291188 | |
188 | Phosphorylation | ETVKGVCSNFLCDLA CCEEEHHHHCCCCCC | 28.36 | - | |
210 | Sulfoxidation | TGPVGKEMLMPKDPN ECCCCCCCCCCCCCC | 4.41 | 25693801 | |
212 | Sulfoxidation | PVGKEMLMPKDPNAT CCCCCCCCCCCCCCE | 3.60 | 25693801 | |
219 | Phosphorylation | MPKDPNATVIMLATG CCCCCCCEEEEEEEC | 19.73 | 22092075 | |
286 | Nitration | PENFRVDYAISREQA CCCCCCCEEEEHHHC | 11.72 | - | |
309 | Nitration | IQTRMAQYAAELWEL HHHHHHHHHHHHHHH | 9.76 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FNRL2_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FNRL2_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FNRL2_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of FNRL2_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...