| UniProt ID | FNRL2_ARATH | |
|---|---|---|
| UniProt AC | Q8W493 | |
| Protein Name | Ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic | |
| Gene Name | LFNR2 {ECO:0000303|Ref.5} | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 369 | |
| Subcellular Localization |
Plastid, chloroplast stroma . Plastid, chloroplast thylakoid membrane Peripheral membrane protein Stromal side . More abundant in the soluble fraction. The presence of LFNR1 is required for association with the thylakoid membrane. |
|
| Protein Description | Plays a key role in regulating the relative amounts of cyclic and non-cyclic electron flow to meet the demands of the plant for ATP and reducing power.. | |
| Protein Sequence | MATTMNAAVSLTSSNSSSFPATSCAIAPERIRFTKGAFYYKSNNVVTGKRVFSIKAQITTETDTPTPAKKVEKVSKKNEEGVIVNRYRPKEPYTGKCLLNTKITADDAPGETWHMVFSHQGEIPYREGQSVGVIADGIDKNGKPHKVRLYSIASSALGDLGNSETVSLCVKRLVYTNDQGETVKGVCSNFLCDLAPGSDVKLTGPVGKEMLMPKDPNATVIMLATGTGIAPFRSFLWKMFFEKHDDYKFNGLAWLFLGVPTTSSLLYQEEFDKMKAKAPENFRVDYAISREQANDKGEKMYIQTRMAQYAAELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAANDGIDWFDYKKQLKKAEQWNVEVY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 87 | Phosphorylation | EGVIVNRYRPKEPYT CCEEEECCCCCCCCC | 26.51 | 25561503 | |
| 125 | Nitration | SHQGEIPYREGQSVG EECCCCCCCCCCEEE | 27.27 | - | |
| 175 | Phosphorylation | LCVKRLVYTNDQGET EEEEEEEEECCCCCC | 12.38 | 28295753 | |
| 176 | Phosphorylation | CVKRLVYTNDQGETV EEEEEEEECCCCCCE | 25.49 | 30291188 | |
| 182 | Phosphorylation | YTNDQGETVKGVCSN EECCCCCCEEEHHHH | 34.05 | 30291188 | |
| 188 | Phosphorylation | ETVKGVCSNFLCDLA CCEEEHHHHCCCCCC | 28.36 | - | |
| 210 | Sulfoxidation | TGPVGKEMLMPKDPN ECCCCCCCCCCCCCC | 4.41 | 25693801 | |
| 212 | Sulfoxidation | PVGKEMLMPKDPNAT CCCCCCCCCCCCCCE | 3.60 | 25693801 | |
| 219 | Phosphorylation | MPKDPNATVIMLATG CCCCCCCEEEEEEEC | 19.73 | 22092075 | |
| 286 | Nitration | PENFRVDYAISREQA CCCCCCCEEEEHHHC | 11.72 | - | |
| 309 | Nitration | IQTRMAQYAAELWEL HHHHHHHHHHHHHHH | 9.76 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FNRL2_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FNRL2_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FNRL2_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of FNRL2_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
