AKT6_ARATH - dbPTM
AKT6_ARATH - PTM Information in dbPTM
Basic Information of Protein
UniProt ID AKT6_ARATH
UniProt AC Q8GXE6
Protein Name Potassium channel AKT6
Gene Name AKT6
Organism Arabidopsis thaliana (Mouse-ear cress).
Sequence Length 888
Subcellular Localization Membrane
Multi-pass membrane protein.
Protein Description Highly selective inward-rectifying potassium channel that could mediate potassium uptake in the pollen membrane. Plays an important role in pollen tube development. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May interact with the cytoskeleton or with regulatory proteins..
Protein Sequence MEKKKVWFWGVKDDGEGGGGRGGGRTKDAEDDVADHLSRDGTMSQYSLSKGLLPSLGANNRSSRDVILPRFIVSPFDPRYRAWETFLVFLVLYTAWASPFEFGFLQKPRPPLSILDNIVNGFFAVDIVLTFFVAFLDKVTYLLVDDPKRIAWRYASTWLIFDVVSTFPYEIFGSLLHESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWVRCSKLLLVTLFVIHCGACFLYSIAAHYPDPSKTFMALTDENWKESPIAVRYNTAMYWSITTFSTTGYGDIHGVNSREMTFILFYMVFNLGLSAYIIGNMTNLVVHVTGRTRKFRDTIQAASGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDKIYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQVVSEAQRGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNLLQHLKDSEDPVMKGVLADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHREIAKLLAENGAKLSLDSVSYFSGLAVEKNCLDALKDIIKYGGDVTLPDGNGTTALHRAVSEGHLEIVKFLLDQGADLDWPDSYGWTPRGLADHQGNEEIKTLFHNHRPVEKKPKPIPGIPQSPVTGKPLMKYSSEPTMHSGELVLDGGQVVVSQKRKLNNFRNSLFGIISAANSADDGGEVPRSPAVPGGGGSMIYPERVTISSPENGETGGKVVLLPNSMEELLKIGENKMGFVPTKVLTREGAEIDDITLIRDGDFLLLSRDP
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of AKT6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of AKT6_ARATH !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of AKT6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of AKT6_ARATH !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of AKT6_ARATH !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of AKT6_ARATH

loading...

Related Literatures of Post-Translational Modification

TOP