dbPTM

AKT6_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	AKT6_ARATH
UniProt AC	Q8GXE6
Protein Name	Potassium channel AKT6
Gene Name	AKT6
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	888
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description	Highly selective inward-rectifying potassium channel that could mediate potassium uptake in the pollen membrane. Plays an important role in pollen tube development. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by hyperpolarization. May interact with the cytoskeleton or with regulatory proteins..
Protein Sequence	MEKKKVWFWGVKDDGEGGGGRGGGRTKDAEDDVADHLSRDGTMSQYSLSKGLLPSLGANNRSSRDVILPRFIVSPFDPRYRAWETFLVFLVLYTAWASPFEFGFLQKPRPPLSILDNIVNGFFAVDIVLTFFVAFLDKVTYLLVDDPKRIAWRYASTWLIFDVVSTFPYEIFGSLLHESIQGYGIFSMLRLWRLRRVSNCFARLEKDRKYSYFWVRCSKLLLVTLFVIHCGACFLYSIAAHYPDPSKTFMALTDENWKESPIAVRYNTAMYWSITTFSTTGYGDIHGVNSREMTFILFYMVFNLGLSAYIIGNMTNLVVHVTGRTRKFRDTIQAASGFGQRNNLPVRLQDQMVAHLCLRYRTDSEGLQQQEIIDSLPKAIRSSISHYLFYEVVDKIYLFHGISNDLLFQLVTEMKAEYFPPKEDVILQNEAPTDFYILVTGAVDIIARVNGVEQVVSEAQRGHVFGEVGVLCYRPQLFTVRTKRLSQLLRLNRTVLLNLVQANVGDGAIIMNNLLQHLKDSEDPVMKGVLADTEHMLAQGKMDLPLSLCFAAARGDDLLLHQLLRRGSSPNEMDKDGRTALHIAASKGSHYCVVLLLEHGADPNIRDSEGNVPLWEAIIGRHREIAKLLAENGAKLSLDSVSYFSGLAVEKNCLDALKDIIKYGGDVTLPDGNGTTALHRAVSEGHLEIVKFLLDQGADLDWPDSYGWTPRGLADHQGNEEIKTLFHNHRPVEKKPKPIPGIPQSPVTGKPLMKYSSEPTMHSGELVLDGGQVVVSQKRKLNNFRNSLFGIISAANSADDGGEVPRSPAVPGGGGSMIYPERVTISSPENGETGGKVVLLPNSMEELLKIGENKMGFVPTKVLTREGAEIDDITLIRDGDFLLLSRDP

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of AKT6_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of AKT6_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of AKT6_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of AKT6_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of AKT6_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of AKT6_ARATH

Related Literatures of Post-Translational Modification