SPL3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPL3_ARATH
• UniProt AC: P93015
• Protein Name: Squamosa promoter-binding-like protein 3
• Gene Name: SPL3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 131
• Subcellular Localization: Nucleus . Cytoplasm . Mostly located in nucleus.
• Protein Description: Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. Promotes both vegetative phase change and flowering. Regulates phase-specific patterns of leaf epidermal differentiation and flowering time, but does not seem to affect leaf shape..
• Protein Sequence: MSMRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSGVCQVESCTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRLAGHNERRRKSTTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
18	Phosphorylation	KRSLRELSEEEEEEE HHHHHHHCHHHHHHH	37.90	30291188
27	Phosphorylation	EEEEEEETEDEDTFE HHHHHHHCCCCCCHH	52.60	27531888

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPL3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPL3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPL3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of SPL3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.