CML36_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CML36_ARATH
• UniProt AC: Q9SS31
• Protein Name: Probable calcium-binding protein CML36
• Gene Name: CML36
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 209
• Protein Description: Potential calcium sensor..
• Protein Sequence: MKLAKLIPKRFFIRSKDRSTVSKSPTAFSFGSASSSSGQDCKNSGGDGGGGSVTPTSILPEVPSPYSYVEILQAFKLIDRDNDGAVSRHDLESLLSRLGPDPLTEEEINVMLKEVDCDGDGTIRLEELASRVVSLDPARDSTELKETFEFFDADRDGLISADELLRVFSTIGDERCTLDDCKRMIADVDEDGDGFVCFTEFSRMMDLQR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
29	Phosphorylation	SKSPTAFSFGSASSS CCCCCEEECCCCCCC	26.66	17317660
141	Phosphorylation	SLDPARDSTELKETF ECCCCCCCHHHHHHH	20.44	17317660
142	Phosphorylation	LDPARDSTELKETFE CCCCCCCHHHHHHHE	50.02	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CML36_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CML36_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CML36_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of CML36_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.