dbPTM

DIRL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DIRL1_ARATH
UniProt AC	Q8W453
Protein Name	Putative lipid-transfer protein DIR1
Gene Name	DIR1
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	102
Subcellular Localization	Secreted, extracellular space, apoplast . Endoplasmic reticulum . Cell junction, plasmodesma .
Protein Description	Putative lipid transfer protein required for systemic acquired resistance (SAR) long distance signaling. May interact with a lipid-derived molecule to promote long distance signaling associated with SAR. Together with AZI1, required for glycerol-3-phosphate- (G3P) and azelaic acid- (AA) induced systemic acquired resistance (SAR). Component of plant systemic immunity involved in priming defenses in a AA-dependent manner, by modulating production and/or translocation of a mobile signal(s) during SAR..
Protein Sequence	MASKKAAMVMMAMIVIMAMLVDTSVAIDLCGMSQDELNECKPAVSKENPTSPSQPCCTALQHADFACLCGYKNSPWLGSFGVDPELASALPKQCGLANAPTC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DIRL1_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DIRL1_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DIRL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DIRL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of DIRL1_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DIRL1_ARATH

Related Literatures of Post-Translational Modification