VSP2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VSP2_ARATH
• UniProt AC: O82122
• Protein Name: Vegetative storage protein 2
• Gene Name: VSP2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 265
• Protein Description: May function as somatic storage protein during early seedling development..
• Protein Sequence: MKILSLSLLLLLAATVSASVPGLIELVDSKTIFGNVAELLEKEKLSINYANCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTGASTPGLPEALHLYQNIIELGIEPIILSDRWKLWKNVTLDNLEAAGVTYWKHLILKPNGSNLRQVVYKSKVRKSLVKKGYNIVGNIGDQWADLVEDTPGRVFKLPNPLYYVPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
31	Phosphorylation	IELVDSKTIFGNVAE HHHHCCCCCCCCHHH	26.03	22074104
110	N-linked_Glycosylation	AKGLALKNDTVNVWI HHCEECCCCEEEEEE	51.54	-
188	N-linked_Glycosylation	DRWKLWKNVTLDNLE CHHHHHCCCCHHHHH	22.03	-
210	N-linked_Glycosylation	KHLILKPNGSNLRQV EEEEECCCCCCHHHH	66.01	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VSP2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VSP2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VSP2_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of VSP2_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.