SPCS2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: SPCS2_ARATH
• UniProt AC: P58684
• Protein Name: Probable signal peptidase complex subunit 2
• Gene Name: At2g39960
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 192
• Subcellular Localization: Membrane ; Multi-pass membrane protein . Microsome membrane ; Multi-pass membrane protein . Endoplasmic reticulum membrane ; Multi-pass membrane protein .
• Protein Description: Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum..
• Protein Sequence: MEEKKTESTNKNVKKANLLDHHSIKHILDESVSDIVTSRGYKEDVRLSNLKLILGTIIIVVALVAQFYNKKFPENRDFLIGCIALYVVLNAVLQLILYTKEKNAILFTYPPEGSFTSTGLVVSSKLPRFSDQYTLTIDSADPKSISAGKSVQLTKSVTQWFTKDGVLVEGLFWKDVEALIKNYAEEEPKKKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of SPCS2_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of SPCS2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of SPCS2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of SPCS2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
NIP11_ARATH	NLM1	physical	21798944
NAC89_ARATH	NAC089	physical	21798944
RTNLD_ARATH	BTI3	physical	21798944

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.