| UniProt ID | ZN414_HUMAN | |
|---|---|---|
| UniProt AC | Q96IQ9 | |
| Protein Name | Zinc finger protein 414 | |
| Gene Name | ZNF414 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 312 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | May be involved in transcriptional regulation.. | |
| Protein Sequence | MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHLRTHCPPTQSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEHAQSPAPPPPPALDREPPAPERPPEVDPASAPGLPFPLLEPFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRPQGGSDAPSGACR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 29 (in isoform 2) | Phosphorylation | - | 18.91 | 27251275 | |
| 29 | Phosphorylation | ETDKEVLSPAVPAAA CCCHHHHCCCCCCCC | 18.91 | 22199227 | |
| 38 | Phosphorylation | AVPAAAPSSSMSEEP CCCCCCCCCCCCCCC | 30.25 | 22199227 | |
| 39 | Phosphorylation | VPAAAPSSSMSEEPG CCCCCCCCCCCCCCC | 29.06 | 22199227 | |
| 40 | Phosphorylation | PAAAPSSSMSEEPGP CCCCCCCCCCCCCCH | 30.57 | 22199227 | |
| 42 | Phosphorylation | AAPSSSMSEEPGPEQ CCCCCCCCCCCCHHH | 40.53 | 22199227 | |
| 52 (in isoform 2) | Phosphorylation | - | 31.01 | 27251275 | |
| 52 | Phosphorylation | PGPEQAATPPVWERG CCHHHCCCCCCCCCC | 31.01 | 22199227 | |
| 68 | Phosphorylation | AGGMQQGSSPAPDSC CCCCCCCCCCCCCCC | 28.89 | 28348404 | |
| 69 | Phosphorylation | GGMQQGSSPAPDSCQ CCCCCCCCCCCCCCC | 31.72 | 26657352 | |
| 69 (in isoform 2) | Phosphorylation | - | 31.72 | 27251275 | |
| 112 | Phosphorylation | PGKQIPCSSPGCCLS CCCCCCCCCCCCCCC | 33.92 | 25627689 | |
| 113 | Phosphorylation | GKQIPCSSPGCCLSF CCCCCCCCCCCCCCC | 31.84 | 21712546 | |
| 139 | Phosphorylation | THCPPTQSLEGKLFR HHCCCCCCCCCCEEE | 30.76 | - | |
| 148 (in isoform 2) | Phosphorylation | - | 28.17 | 24719451 | |
| 148 | Phosphorylation | EGKLFRCSALSCTET CCCEEEEECCCCCCC | 28.17 | 24719451 | |
| 153 (in isoform 2) | Phosphorylation | - | 34.38 | 24719451 | |
| 153 | Phosphorylation | RCSALSCTETFPSMQ EEECCCCCCCCCCHH | 34.38 | 24719451 | |
| 177 | Methylation | YKPNRYFKCENCLLR CCCCCCCCCCCCHHH | 31.53 | 115978227 | |
| 190 (in isoform 2) | Phosphorylation | - | 30.47 | 24719451 | |
| 190 | Phosphorylation | LRFRTHRSLFKHLHV HHHHHHHHHHHHHHH | 30.47 | 24719451 | |
| 204 | Phosphorylation | VCAEHAQSPAPPPPP HHHHHCCCCCCCCCC | 24.66 | 20873877 | |
| 265 | Phosphorylation | NPAPFGLSPPRLRPF CCCCCCCCCCCCHHH | 32.98 | 24719451 | |
| 270 | Methylation | GLSPPRLRPFLAAAP CCCCCCCHHHHHCCC | 22.62 | 115388085 | |
| 282 | Phosphorylation | AAPGPPASSAAVWKK CCCCCCCCHHHHHHH | 26.70 | - | |
| 290 | Phosphorylation | SAAVWKKSQGAGSSP HHHHHHHCCCCCCCC | 30.07 | 26074081 | |
| 290 (in isoform 2) | Phosphorylation | - | 30.07 | 24247654 | |
| 295 | Phosphorylation | KKSQGAGSSPRRPQG HHCCCCCCCCCCCCC | 36.31 | 25159151 | |
| 295 (in isoform 2) | Phosphorylation | - | 36.31 | 28111955 | |
| 296 (in isoform 2) | Phosphorylation | - | 22.85 | 20201521 | |
| 296 | Phosphorylation | KSQGAGSSPRRPQGG HCCCCCCCCCCCCCC | 22.85 | 25159151 | |
| 304 (in isoform 2) | Phosphorylation | - | 37.11 | 28111955 | |
| 304 | Phosphorylation | PRRPQGGSDAPSGAC CCCCCCCCCCCCCCC | 37.11 | 26074081 | |
| 308 | Phosphorylation | QGGSDAPSGACR--- CCCCCCCCCCCC--- | 40.52 | 26074081 | |
| 315 (in isoform 2) | Methylation | - | - | ||
| 376 (in isoform 2) | Phosphorylation | - | 30108239 | ||
| 380 (in isoform 2) | Phosphorylation | - | 30108239 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN414_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN414_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN414_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...