UniProt ID | ZN414_HUMAN | |
---|---|---|
UniProt AC | Q96IQ9 | |
Protein Name | Zinc finger protein 414 | |
Gene Name | ZNF414 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 312 | |
Subcellular Localization | Nucleus . | |
Protein Description | May be involved in transcriptional regulation.. | |
Protein Sequence | MEEKPSGPIPDMLATAEPSSSETDKEVLSPAVPAAAPSSSMSEEPGPEQAATPPVWERGGAGGMQQGSSPAPDSCQPGPGPSPGLTSIVSGTSEDLRPPRRRPPPGKQIPCSSPGCCLSFPSVRDLAQHLRTHCPPTQSLEGKLFRCSALSCTETFPSMQELVAHSKLHYKPNRYFKCENCLLRFRTHRSLFKHLHVCAEHAQSPAPPPPPALDREPPAPERPPEVDPASAPGLPFPLLEPFTTPAPAPTGPFLPYLNPAPFGLSPPRLRPFLAAAPGPPASSAAVWKKSQGAGSSPRRPQGGSDAPSGACR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
29 (in isoform 2) | Phosphorylation | - | 18.91 | 27251275 | |
29 | Phosphorylation | ETDKEVLSPAVPAAA CCCHHHHCCCCCCCC | 18.91 | 22199227 | |
38 | Phosphorylation | AVPAAAPSSSMSEEP CCCCCCCCCCCCCCC | 30.25 | 22199227 | |
39 | Phosphorylation | VPAAAPSSSMSEEPG CCCCCCCCCCCCCCC | 29.06 | 22199227 | |
40 | Phosphorylation | PAAAPSSSMSEEPGP CCCCCCCCCCCCCCH | 30.57 | 22199227 | |
42 | Phosphorylation | AAPSSSMSEEPGPEQ CCCCCCCCCCCCHHH | 40.53 | 22199227 | |
52 (in isoform 2) | Phosphorylation | - | 31.01 | 27251275 | |
52 | Phosphorylation | PGPEQAATPPVWERG CCHHHCCCCCCCCCC | 31.01 | 22199227 | |
68 | Phosphorylation | AGGMQQGSSPAPDSC CCCCCCCCCCCCCCC | 28.89 | 28348404 | |
69 | Phosphorylation | GGMQQGSSPAPDSCQ CCCCCCCCCCCCCCC | 31.72 | 26657352 | |
69 (in isoform 2) | Phosphorylation | - | 31.72 | 27251275 | |
112 | Phosphorylation | PGKQIPCSSPGCCLS CCCCCCCCCCCCCCC | 33.92 | 25627689 | |
113 | Phosphorylation | GKQIPCSSPGCCLSF CCCCCCCCCCCCCCC | 31.84 | 21712546 | |
139 | Phosphorylation | THCPPTQSLEGKLFR HHCCCCCCCCCCEEE | 30.76 | - | |
148 (in isoform 2) | Phosphorylation | - | 28.17 | 24719451 | |
148 | Phosphorylation | EGKLFRCSALSCTET CCCEEEEECCCCCCC | 28.17 | 24719451 | |
153 (in isoform 2) | Phosphorylation | - | 34.38 | 24719451 | |
153 | Phosphorylation | RCSALSCTETFPSMQ EEECCCCCCCCCCHH | 34.38 | 24719451 | |
177 | Methylation | YKPNRYFKCENCLLR CCCCCCCCCCCCHHH | 31.53 | 115978227 | |
190 (in isoform 2) | Phosphorylation | - | 30.47 | 24719451 | |
190 | Phosphorylation | LRFRTHRSLFKHLHV HHHHHHHHHHHHHHH | 30.47 | 24719451 | |
204 | Phosphorylation | VCAEHAQSPAPPPPP HHHHHCCCCCCCCCC | 24.66 | 20873877 | |
265 | Phosphorylation | NPAPFGLSPPRLRPF CCCCCCCCCCCCHHH | 32.98 | 24719451 | |
270 | Methylation | GLSPPRLRPFLAAAP CCCCCCCHHHHHCCC | 22.62 | 115388085 | |
282 | Phosphorylation | AAPGPPASSAAVWKK CCCCCCCCHHHHHHH | 26.70 | - | |
290 | Phosphorylation | SAAVWKKSQGAGSSP HHHHHHHCCCCCCCC | 30.07 | 26074081 | |
290 (in isoform 2) | Phosphorylation | - | 30.07 | 24247654 | |
295 | Phosphorylation | KKSQGAGSSPRRPQG HHCCCCCCCCCCCCC | 36.31 | 25159151 | |
295 (in isoform 2) | Phosphorylation | - | 36.31 | 28111955 | |
296 (in isoform 2) | Phosphorylation | - | 22.85 | 20201521 | |
296 | Phosphorylation | KSQGAGSSPRRPQGG HCCCCCCCCCCCCCC | 22.85 | 25159151 | |
304 (in isoform 2) | Phosphorylation | - | 37.11 | 28111955 | |
304 | Phosphorylation | PRRPQGGSDAPSGAC CCCCCCCCCCCCCCC | 37.11 | 26074081 | |
308 | Phosphorylation | QGGSDAPSGACR--- CCCCCCCCCCCC--- | 40.52 | 26074081 | |
315 (in isoform 2) | Methylation | - | - | ||
376 (in isoform 2) | Phosphorylation | - | 30108239 | ||
380 (in isoform 2) | Phosphorylation | - | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ZN414_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ZN414_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ZN414_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...