dbPTM

YO162_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YO162_YEAST
UniProt AC	P0CF19
Protein Name	Putative uncharacterized transporter YOL162W
Gene Name	YOL162W
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	215
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MGLLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWSTEKCNNRLGLSLLQPLYTVPLLAVLRFWKGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQSVKTRTVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLALFMFPILIGSKLIYVYINKQRDKRWNAMSEEEKDHYLSTTSDAGSRRLDFRFYH

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
190	Phosphorylation	DKRWNAMSEEEKDHY HHHHHCCCHHHHHHC	39.17	27717283

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YO162_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YO162_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YO162_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATG32_YEAST	ATG32	genetic	27708008
YM24_YEAST	YMR147W	genetic	27708008
DMA2_YEAST	DMA2	genetic	27708008
YAJ9_YEAST	YAR029W	genetic	27708008
UBP13_YEAST	UBP13	genetic	27708008
TREB_YEAST	NTH2	genetic	27708008
UGA2_YEAST	UGA2	genetic	27708008
SCO2_YEAST	SCO2	genetic	27708008
RAD16_YEAST	RAD16	genetic	27708008
SHG1_YEAST	SHG1	genetic	27708008
MRC1_YEAST	MRC1	genetic	27708008
IMG2_YEAST	IMG2	genetic	27708008
NBP2_YEAST	NBP2	genetic	27708008
MSN5_YEAST	MSN5	genetic	27708008
PDR15_YEAST	PDR15	genetic	27708008
PUF6_YEAST	PUF6	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
MGA1_YEAST	MGA1	genetic	27708008
YG5L_YEAST	YGR266W	genetic	27708008
AIR1_YEAST	AIR1	genetic	27708008
SDHX_YEAST	YJL045W	genetic	27708008
PIR5_YEAST	YJL160C	genetic	27708008
ADY4_YEAST	ADY4	genetic	27708008
PSY3_YEAST	PSY3	genetic	27708008
CDC73_YEAST	CDC73	genetic	27708008
PUR92_YEAST	ADE17	genetic	27708008
COQ2_YEAST	COQ2	genetic	27708008
IZH2_YEAST	IZH2	genetic	27708008
2A5D_YEAST	RTS1	genetic	27708008
ECM3_YEAST	ECM3	genetic	27708008
MCA1_YEAST	MCA1	genetic	27708008
RAD1_YEAST	RAD1	genetic	27708008
YP272_YEAST	PBI1	genetic	27708008
CTF4_YEAST	CTF4	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YO162_YEAST

Related Literatures of Post-Translational Modification