UniProt ID | SSXT_HUMAN | |
---|---|---|
UniProt AC | Q15532 | |
Protein Name | Protein SSXT | |
Gene Name | SS18 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 418 | |
Subcellular Localization | Nucleus . | |
Protein Description | Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation.. | |
Protein Sequence | MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MSVAFAAPR ------CCCCCCCCC | 23.35 | 22814378 | |
9 | Methylation | SVAFAAPRQRGKGEI CCCCCCCCCCCCCCC | 33.82 | - | |
13 | Ubiquitination | AAPRQRGKGEITPAA CCCCCCCCCCCCHHH | 56.40 | - | |
17 | Phosphorylation | QRGKGEITPAAIQKM CCCCCCCCHHHHHHH | 11.54 | 28555341 | |
41 | Ubiquitination | CIMDSQNKGKTSECS HHHHCCCCCCCCHHH | 54.89 | - | |
413 | Phosphorylation | YGYDQGQYGNYQQ-- CCCCCCCCCCCCC-- | 17.73 | 27642862 | |
416 | Phosphorylation | DQGQYGNYQQ----- CCCCCCCCCC----- | 12.15 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSXT_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSXT_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSXT_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...