| UniProt ID | SSXT_HUMAN | |
|---|---|---|
| UniProt AC | Q15532 | |
| Protein Name | Protein SSXT | |
| Gene Name | SS18 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 418 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Appears to function synergistically with RBM14 as a transcriptional coactivator. Isoform 1 and isoform 2 function in nuclear receptor coactivation. Isoform 1 and isoform 2 function in general transcriptional coactivation.. | |
| Protein Sequence | MSVAFAAPRQRGKGEITPAAIQKMLDDNNHLIQCIMDSQNKGKTSECSQYQQMLHTNLVYLATIADSNQNMQSLLPAPPTQNMPMGPGGMNQSGPPPPPRSHNMPSDGMVGGGPPAPHMQNQMNGQMPGPNHMPMQGPGPNQLNMTNSSMNMPSSSHGSMGGYNHSVPSSQSMPVQNQMTMSQGQPMGNYGPRPNMSMQPNQGPMMHQQPPSQQYNMPQGGGQHYQGQQPPMGMMGQVNQGNHMMGQRQIPPYRPPQQGPPQQYSGQEDYYGDQYSHGGQGPPEGMNQQYYPDGHNDYGYQQPSYPEQGYDRPYEDSSQHYYEGGNSQYGQQQDAYQGPPPQQGYPPQQQQYPGQQGYPGQQQGYGPSQGGPGPQYPNYPQGQGQQYGGYRPTQPGPPQPPQQRPYGYDQGQYGNYQQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSVAFAAPR ------CCCCCCCCC | 23.35 | 22814378 | |
| 9 | Methylation | SVAFAAPRQRGKGEI CCCCCCCCCCCCCCC | 33.82 | - | |
| 13 | Ubiquitination | AAPRQRGKGEITPAA CCCCCCCCCCCCHHH | 56.40 | - | |
| 17 | Phosphorylation | QRGKGEITPAAIQKM CCCCCCCCHHHHHHH | 11.54 | 28555341 | |
| 41 | Ubiquitination | CIMDSQNKGKTSECS HHHHCCCCCCCCHHH | 54.89 | - | |
| 413 | Phosphorylation | YGYDQGQYGNYQQ-- CCCCCCCCCCCCC-- | 17.73 | 27642862 | |
| 416 | Phosphorylation | DQGQYGNYQQ----- CCCCCCCCCC----- | 12.15 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SSXT_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SSXT_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SSXT_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
