UniProt ID | IKBD_HUMAN | |
---|---|---|
UniProt AC | Q8NI38 | |
Protein Name | NF-kappa-B inhibitor delta | |
Gene Name | NFKBID | |
Organism | Homo sapiens (Human). | |
Sequence Length | 313 | |
Subcellular Localization | Nucleus . | |
Protein Description | Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR). May also regulate TCR-induced negative selection of thymocytes.. | |
Protein Sequence | MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
200 | Phosphorylation | LQMGANHTSQEIKSN HHCCCCCCCHHHHCC | 31.73 | - | |
201 | Phosphorylation | QMGANHTSQEIKSNK HCCCCCCCHHHHCCC | 20.47 | - | |
312 | Phosphorylation | RVAPPGLSS------ CCCCCCCCC------ | 39.66 | 30108239 | |
313 | Phosphorylation | VAPPGLSS------- CCCCCCCC------- | 49.65 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IKBD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IKBD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IKBD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CA094_HUMAN | C1orf94 | physical | 25416956 | |
TRIM9_HUMAN | TRIM9 | physical | 25416956 | |
K1C40_HUMAN | KRT40 | physical | 25416956 | |
NFKB1_HUMAN | NFKB1 | physical | 28514442 | |
REL_HUMAN | REL | physical | 28514442 | |
NFKB2_HUMAN | NFKB2 | physical | 28514442 | |
XPF_HUMAN | ERCC4 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...