| UniProt ID | IKBD_HUMAN | |
|---|---|---|
| UniProt AC | Q8NI38 | |
| Protein Name | NF-kappa-B inhibitor delta | |
| Gene Name | NFKBID | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 313 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Regulates the expression of IL-2, IL-6, and other cytokines through regulation on NF-kappa-B activity. Functions in the regulation of inflammatory responses. Involved in the induction of T helper 17 cells (Th17) differentiation upon recognition of antigen by T cell antigen receptor (TCR). May also regulate TCR-induced negative selection of thymocytes.. | |
| Protein Sequence | MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 200 | Phosphorylation | LQMGANHTSQEIKSN HHCCCCCCCHHHHCC | 31.73 | - | |
| 201 | Phosphorylation | QMGANHTSQEIKSNK HCCCCCCCHHHHCCC | 20.47 | - | |
| 312 | Phosphorylation | RVAPPGLSS------ CCCCCCCCC------ | 39.66 | 30108239 | |
| 313 | Phosphorylation | VAPPGLSS------- CCCCCCCC------- | 49.65 | 30108239 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IKBD_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IKBD_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IKBD_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CA094_HUMAN | C1orf94 | physical | 25416956 | |
| TRIM9_HUMAN | TRIM9 | physical | 25416956 | |
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| NFKB1_HUMAN | NFKB1 | physical | 28514442 | |
| REL_HUMAN | REL | physical | 28514442 | |
| NFKB2_HUMAN | NFKB2 | physical | 28514442 | |
| XPF_HUMAN | ERCC4 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...