ACL6B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ACL6B_HUMAN
• UniProt AC: O94805
• Protein Name: Actin-like protein 6B
• Gene Name: ACTL6B
• Organism: Homo sapiens (Human).
• Sequence Length: 426
• Subcellular Localization: Nucleus .
• Protein Description: Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Belongs to the neuron-specific chromatin remodeling complex (nBAF complex), as such plays a role in remodeling mononucleosomes in an ATP-dependent fashion, and is required for postmitotic neural development and dendritic outgrowth. During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth. ACTL6B/BAF53B is not essential for assembly of the nBAF complex but is required for targeting the complex and CREST to the promoter of genes essential for dendritic growth (By similarity)..
• Protein Sequence: MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMPTVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGGNTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQCVERKCP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSGGVYGGD ------CCCCCCCCC	44.23	-
2	Acetylation	------MSGGVYGGD ------CCCCCCCCC	44.23	-
6	Phosphorylation	--MSGGVYGGDEVGA --CCCCCCCCCCCEE	20.75	18491316
83	Phosphorylation	RDGAEVMSPLKNGMI CCCCCCCCCCCCCCC	32.05	-
104	Phosphorylation	RAILDHTYSKHVKSE HHHHHHCHHHCCCCC	16.59	25884760
126	Phosphorylation	MSEAPWNTRAKREKL CCCCCCCHHHHHHHH	28.30	-
134	Phosphorylation	RAKREKLTELMFEQY HHHHHHHHHHHHHHC	37.83	24719451
141	Phosphorylation	TELMFEQYNIPAFFL HHHHHHHCCCCHHHH	14.09	27174698
155	Phosphorylation	LCKTAVLTAFANGRS HHHHHHHHHHHCCCC	17.09	24719451
183	Phosphorylation	AIPVHDGYVLQQGIV EEEECCCEEEEECEE	12.21	-
191	Acetylation	VLQQGIVKSPLAGDF EEEECEECCCCCCCH	44.42	26051181
204	Methylation	DFISMQCRELFQEMA CHHHHHHHHHHHHHH	27.11	-
244	Phosphorylation	KEKLPQVSKSWHNYM HHHCCCCCHHHHHHH	18.74	20068231
366	Phosphorylation	DRLNRELSQKTPPSM HHHHHHHHHCCCCHH	25.52	29083192
368	Ubiquitination	LNRELSQKTPPSMRL HHHHHHHCCCCHHHE	60.67	21906983
368	Acetylation	LNRELSQKTPPSMRL HHHHHHHCCCCHHHE	60.67	25953088
369	Phosphorylation	NRELSQKTPPSMRLK HHHHHHCCCCHHHEE	32.56	20860994
372	Phosphorylation	LSQKTPPSMRLKLIA HHHCCCCHHHEEEHH	20.10	20860994
382	Phosphorylation	LKLIASNSTMERKFS EEEHHCCCCCCCCCC	27.00	23403867
383	Phosphorylation	KLIASNSTMERKFSP EEHHCCCCCCCCCCC	27.57	23403867
395	Phosphorylation	FSPWIGGSILASLGT CCCCCCHHHHHHHHH	14.82	22210691
399	Phosphorylation	IGGSILASLGTFQQM CCHHHHHHHHHHHHH	24.72	22210691
413	Phosphorylation	MWISKQEYEEGGKQC HHHCHHHHHCCHHCC	19.45	22210691
418	Ubiquitination	QEYEEGGKQCVERKC HHHHCCHHCCCCCCC	51.92	30230243
418	Acetylation	QEYEEGGKQCVERKC HHHHCCHHCCCCCCC	51.92	26051181

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ACL6B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ACL6B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ACL6B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CTBP1_HUMAN	CTBP1	genetic	12565893
CTBP1_HUMAN	CTBP1	physical	12565893
A4_HUMAN	APP	physical	21832049
MED14_HUMAN	MED14	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.