| UniProt ID | HAUS4_MOUSE | |
|---|---|---|
| UniProt AC | Q8BFT2 | |
| Protein Name | HAUS augmin-like complex subunit 4 | |
| Gene Name | Haus4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 363 | |
| Subcellular Localization | Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle. Localizes to interphase centrosomes and to mitotic spindle microtubules.. | |
| Protein Description | Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex.. | |
| Protein Sequence | MASGDFCAPGEGVEMLLQVCGKQFPPCALTEEDLIQNPRFSKLLLSLSQHVDESGLSLTLAKEQAQAWSEVRHRKTAWLRYEILQRVIQELLVDYYVKAQDTNLTSEDKKFHETLEQRLLVTELTQLSGPGQETELPPLLGLERTDLLELMPPSQDFVWMKARLQLEVEEQLKRKCFTLLCYHDPSSDTDGDTLKAAKVWTLTEVLVREKQQCLEAKSQQKEQLVLLEKKRTTYSQVLLRCLALLQRLLQEHRLQTKSELDRINAQYLELKCSAMILRLRMEELKVLSDTYSAEKVEMHRLIRDRLEGAIRLQEQDLEKSRLVLHTYEALGEDFESLVREYTQLRLAADNKRWALQELSKAQR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of HAUS4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HAUS4_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HAUS4_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HAUS4_MOUSE !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...