UniProt ID | EXOS2_HUMAN | |
---|---|---|
UniProt AC | Q13868 | |
Protein Name | Exosome complex component RRP4 | |
Gene Name | EXOSC2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 293 | |
Subcellular Localization | Cytoplasm. Nucleus, nucleolus. Nucleus. | |
Protein Description | Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC2 as peripheral part of the Exo-9 complex stabilizes the hexameric ring of RNase PH-domain subunits through contacts with EXOSC4 and EXOSC7.. | |
Protein Sequence | MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Phosphorylation | PVARKPLSERLGRDT CCCCCCHHHHHCCCC | 29.24 | 20068231 | |
24 | Ubiquitination | RLGRDTKKHLVVPGD HHCCCCCCCEEECCC | 44.24 | - | |
32 | Phosphorylation | HLVVPGDTITTDTGF CEEECCCEEECCCCC | 26.58 | 22817900 | |
37 | Phosphorylation | GDTITTDTGFMRGHG CCEEECCCCCCCCCC | 30.17 | 22817900 | |
41 | Methylation | TTDTGFMRGHGTYMG ECCCCCCCCCCCCCC | 31.53 | 115492941 | |
45 | Phosphorylation | GFMRGHGTYMGEEKL CCCCCCCCCCCCHHH | 12.50 | 22817900 | |
46 | Phosphorylation | FMRGHGTYMGEEKLI CCCCCCCCCCCHHHH | 14.02 | 22817900 | |
51 | Ubiquitination | GTYMGEEKLIASVAG CCCCCCHHHHHHHHC | 40.67 | - | |
55 | Phosphorylation | GEEKLIASVAGSVER CCHHHHHHHHCCHHH | 12.90 | 23532336 | |
59 | Phosphorylation | LIASVAGSVERVNKL HHHHHHCCHHHHHHH | 15.86 | 25003641 | |
65 | Acetylation | GSVERVNKLICVKAL CCHHHHHHHHHHHHC | 36.05 | 25953088 | |
65 | Ubiquitination | GSVERVNKLICVKAL CCHHHHHHHHHHHHC | 36.05 | - | |
68 | S-nitrosylation | ERVNKLICVKALKTR HHHHHHHHHHHCCCE | 3.58 | 19483679 | |
68 | S-nitrosocysteine | ERVNKLICVKALKTR HHHHHHHHHHHCCCE | 3.58 | - | |
70 | 2-Hydroxyisobutyrylation | VNKLICVKALKTRYI HHHHHHHHHCCCEEC | 43.52 | - | |
70 | Acetylation | VNKLICVKALKTRYI HHHHHHHHHCCCEEC | 43.52 | 25953088 | |
70 | Ubiquitination | VNKLICVKALKTRYI HHHHHHHHHCCCEEC | 43.52 | - | |
94 | 2-Hydroxyisobutyrylation | RITEVQQKRWKVETN EHHHHHHHCCCCCCC | 43.04 | - | |
94 (in isoform 3) | Phosphorylation | - | 43.04 | 28731282 | |
94 | Acetylation | RITEVQQKRWKVETN EHHHHHHHCCCCCCC | 43.04 | 25953088 | |
94 | Ubiquitination | RITEVQQKRWKVETN EHHHHHHHCCCCCCC | 43.04 | - | |
97 | Ubiquitination | EVQQKRWKVETNSRL HHHHHCCCCCCCCCH | 33.94 | - | |
97 | Acetylation | EVQQKRWKVETNSRL HHHHHCCCCCCCCCH | 33.94 | 26051181 | |
106 | Phosphorylation | ETNSRLDSVLLLSSM CCCCCHHHHHHHHHC | 21.18 | 23612710 | |
111 | Phosphorylation | LDSVLLLSSMNLPGG HHHHHHHHHCCCCCC | 27.75 | 22496350 | |
112 | Phosphorylation | DSVLLLSSMNLPGGE HHHHHHHHCCCCCCH | 16.20 | 22496350 | |
124 | Phosphorylation | GGELRRRSAEDELAM CCHHCCCCHHHHHHH | 33.91 | 29255136 | |
131 | Sulfoxidation | SAEDELAMRGFLQEG CHHHHHHHHHHCCCC | 7.23 | 21406390 | |
135 | Ubiquitination | ELAMRGFLQEGDLIS HHHHHHHCCCCCEEE | 5.16 | - | |
150 | Ubiquitination | AEVQAVFSDGAVSLH EEEEEHHCCCCEEEE | 28.65 | - | |
165 | Ubiquitination | TRSLKYGKLGQGVLV ECEECCCCCCCCEEE | 46.48 | - | |
165 | Acetylation | TRSLKYGKLGQGVLV ECEECCCCCCCCEEE | 46.48 | - | |
175 | Phosphorylation | QGVLVQVSPSLVKRQ CCEEEEECHHHHHCC | 7.53 | 25159151 | |
177 | Phosphorylation | VLVQVSPSLVKRQKT EEEEECHHHHHCCCC | 37.98 | 19413330 | |
180 | Ubiquitination | QVSPSLVKRQKTHFH EECHHHHHCCCCCCC | 55.17 | 21906983 | |
243 | Phosphorylation | RLRNCIISLVTQRMM HHHHHHHHHHHHHHH | 9.25 | 21712546 | |
258 | Phosphorylation | LYDTSILYCYEASLP HHCCHHHHHHHCCCC | 7.42 | 29496907 | |
260 | Phosphorylation | DTSILYCYEASLPHQ CCHHHHHHHCCCCHH | 10.85 | 29496907 | |
269 | Ubiquitination | ASLPHQIKDILKPEI CCCCHHHHHHHCHHH | 31.95 | - | |
273 | Ubiquitination | HQIKDILKPEIMEEI HHHHHHHCHHHHHHH | 40.72 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EXOS2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EXOS2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EXOS2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-165, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-175 AND SER-177, ANDMASS SPECTROMETRY. | |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-124, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-124, AND MASSSPECTROMETRY. | |
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-124, AND MASSSPECTROMETRY. | |
"Automated phosphoproteome analysis for cultured cancer cells by two-dimensional nanoLC-MS using a calcined titania/C18 biphasic column."; Imami K., Sugiyama N., Kyono Y., Tomita M., Ishihama Y.; Anal. Sci. 24:161-166(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-32; THR-37; THR-45 ANDTYR-46, AND MASS SPECTROMETRY. |