UniProt ID | ARF6_HUMAN | |
---|---|---|
UniProt AC | P62330 | |
Protein Name | ADP-ribosylation factor 6 | |
Gene Name | ARF6 {ECO:0000312|HGNC:HGNC:659} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 175 | |
Subcellular Localization |
Cytoplasm, cytosol . Cell membrane Lipid-anchor . Endosome membrane Lipid-anchor. Recycling endosome membrane Lipid-anchor . Cell projection, filopodium membrane Lipid-anchor. Cell projection, ruffle . Cleavage furrow . Midbody, Midbody ring . Golg |
|
Protein Description | GTP-binding protein involved in protein trafficking that regulates endocytic recycling and cytoskeleton remodeling. [PubMed: 11266366] | |
Protein Sequence | MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGKVLSKIF ------CCCHHHHHH | 28.87 | - | |
2 | Myristoylation | ------MGKVLSKIF ------CCCHHHHHH | 28.87 | 7589240 | |
3 | Ubiquitination | -----MGKVLSKIFG -----CCCHHHHHHC | 38.41 | 23000965 | |
7 | Ubiquitination | -MGKVLSKIFGNKEM -CCCHHHHHHCCHHH | 37.58 | 23000965 | |
12 | Ubiquitination | LSKIFGNKEMRILML HHHHHCCHHHEEEEE | 53.95 | 23000965 | |
27 | Phosphorylation | GLDAAGKTTILYKLK EECCCCCEEEEEEEE | 20.39 | 20068231 | |
28 | Phosphorylation | LDAAGKTTILYKLKL ECCCCCEEEEEEEEC | 16.69 | 20068231 | |
31 | Phosphorylation | AGKTTILYKLKLGQS CCCEEEEEEEECCCC | 15.49 | 20068231 | |
32 | Acetylation | GKTTILYKLKLGQSV CCEEEEEEEECCCCE | 35.38 | 22647651 | |
32 | Ubiquitination | GKTTILYKLKLGQSV CCEEEEEEEECCCCE | 35.38 | 21963094 | |
34 | Ubiquitination | TTILYKLKLGQSVTT EEEEEEEECCCCEEE | 46.55 | 32015554 | |
38 | Phosphorylation | YKLKLGQSVTTIPTV EEEECCCCEEECCCC | 21.45 | 26657352 | |
40 | Phosphorylation | LKLGQSVTTIPTVGF EECCCCEEECCCCCE | 25.01 | 28060719 | |
41 | Phosphorylation | KLGQSVTTIPTVGFN ECCCCEEECCCCCEE | 23.85 | 27050516 | |
44 | O-linked_Glycosylation | QSVTTIPTVGFNVET CCEEECCCCCEEEEE | 29.43 | OGP | |
51 | Phosphorylation | TVGFNVETVTYKNVK CCCEEEEEEEEECEE | 17.54 | 20068231 | |
53 | Phosphorylation | GFNVETVTYKNVKFN CEEEEEEEEECEEEE | 35.88 | 20068231 | |
54 | Phosphorylation | FNVETVTYKNVKFNV EEEEEEEEECEEEEE | 9.02 | 20068231 | |
55 | Ubiquitination | NVETVTYKNVKFNVW EEEEEEEECEEEEEE | 45.99 | 23000965 | |
58 | Ubiquitination | TVTYKNVKFNVWDVG EEEEECEEEEEEECC | 40.38 | 23000965 | |
58 | Ubiquitination | TVTYKNVKFNVWDVG EEEEECEEEEEEECC | 40.38 | 21890473 | |
69 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCCCCCHH | 32.50 | 23000965 | |
69 | Ubiquitination | WDVGGQDKIRPLWRH EECCCCCCCCCCCHH | 32.50 | 21890473 | |
69 | Sumoylation | WDVGGQDKIRPLWRH EECCCCCCCCCCCHH | 32.50 | - | |
77 | Phosphorylation | IRPLWRHYYTGTQGL CCCCCHHCCCCCCEE | 8.31 | 28152594 | |
78 | Phosphorylation | RPLWRHYYTGTQGLI CCCCHHCCCCCCEEE | 7.80 | 28152594 | |
79 | Phosphorylation | PLWRHYYTGTQGLIF CCCHHCCCCCCEEEE | 26.96 | 28152594 | |
81 | Phosphorylation | WRHYYTGTQGLIFVV CHHCCCCCCEEEEEE | 16.21 | 28152594 | |
131 | Ubiquitination | QDLPDAMKPHEIQEK CCCCCCCCHHHHHHH | 44.97 | 33845483 | |
138 | Ubiquitination | KPHEIQEKLGLTRIR CHHHHHHHHCCCCCC | 31.32 | 23000965 | |
150 | Phosphorylation | RIRDRNWYVQPSCAT CCCCCCEEECCCCCC | 7.86 | 24043423 | |
154 | Phosphorylation | RNWYVQPSCATSGDG CCEEECCCCCCCCCC | 10.17 | 24043423 | |
157 | Phosphorylation | YVQPSCATSGDGLYE EECCCCCCCCCCHHH | 37.25 | 24043423 | |
158 | Phosphorylation | VQPSCATSGDGLYEG ECCCCCCCCCCHHHC | 19.16 | 24043423 | |
163 | Phosphorylation | ATSGDGLYEGLTWLT CCCCCCHHHCHHHHH | 17.30 | 22817900 | |
167 | Phosphorylation | DGLYEGLTWLTSNYK CCHHHCHHHHHHCCC | 29.32 | 24043423 | |
170 | Phosphorylation | YEGLTWLTSNYKS-- HHCHHHHHHCCCC-- | 13.39 | 24043423 | |
171 | Phosphorylation | EGLTWLTSNYKS--- HCHHHHHHCCCC--- | 35.67 | 24043423 | |
173 | Phosphorylation | LTWLTSNYKS----- HHHHHHCCCC----- | 16.63 | 24043423 | |
174 | Ubiquitination | TWLTSNYKS------ HHHHHCCCC------ | 54.67 | 21963094 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ARF6_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ARF6_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...