UniProt ID | YM007_YEAST | |
---|---|---|
UniProt AC | Q3E7A6 | |
Protein Name | Uncharacterized protein YML007C-A, mitochondrial | |
Gene Name | YML007C-A | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 36 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | ||
Protein Sequence | MVHFIFIALRSMRFMRRLVRNLQYLLLPITSSLLFI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YM007_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YM007_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YM007_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YM007_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APC11_YEAST | APC11 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
SIW14_YEAST | SIW14 | genetic | 27708008 | |
OCA2_YEAST | OCA2 | genetic | 27708008 | |
MAK5_YEAST | MAK5 | genetic | 27708008 | |
TAF5_YEAST | TAF5 | genetic | 27708008 | |
CDC37_YEAST | CDC37 | genetic | 27708008 | |
TFB1_YEAST | TFB1 | genetic | 27708008 | |
COG3_YEAST | COG3 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
STT3_YEAST | STT3 | genetic | 27708008 | |
RNA15_YEAST | RNA15 | genetic | 27708008 | |
TAF6_YEAST | TAF6 | genetic | 27708008 | |
SPC97_YEAST | SPC97 | genetic | 27708008 | |
CFT2_YEAST | CFT2 | genetic | 27708008 | |
GPI12_YEAST | GPI12 | genetic | 27708008 | |
GPI15_YEAST | GPI15 | genetic | 27708008 | |
CAP_YEAST | SRV2 | genetic | 27708008 | |
HRP1_YEAST | HRP1 | genetic | 27708008 | |
RPB2_YEAST | RPB2 | genetic | 27708008 | |
TIM50_YEAST | TIM50 | genetic | 27708008 | |
ARP7_YEAST | ARP7 | genetic | 27708008 | |
ATC3_YEAST | DRS2 | genetic | 27708008 | |
RER1_YEAST | RER1 | genetic | 27708008 | |
MTU1_YEAST | SLM3 | genetic | 27708008 | |
AP18A_YEAST | YAP1801 | genetic | 27708008 | |
DAL81_YEAST | DAL81 | genetic | 27708008 | |
VPS27_YEAST | VPS27 | genetic | 27708008 | |
HAT1_YEAST | HAT1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...