| UniProt ID | YM007_YEAST | |
|---|---|---|
| UniProt AC | Q3E7A6 | |
| Protein Name | Uncharacterized protein YML007C-A, mitochondrial | |
| Gene Name | YML007C-A | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 36 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | ||
| Protein Sequence | MVHFIFIALRSMRFMRRLVRNLQYLLLPITSSLLFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YM007_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YM007_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YM007_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YM007_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| APC11_YEAST | APC11 | genetic | 27708008 | |
| MRM2_YEAST | MRM2 | genetic | 27708008 | |
| SIW14_YEAST | SIW14 | genetic | 27708008 | |
| OCA2_YEAST | OCA2 | genetic | 27708008 | |
| MAK5_YEAST | MAK5 | genetic | 27708008 | |
| TAF5_YEAST | TAF5 | genetic | 27708008 | |
| CDC37_YEAST | CDC37 | genetic | 27708008 | |
| TFB1_YEAST | TFB1 | genetic | 27708008 | |
| COG3_YEAST | COG3 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| STT3_YEAST | STT3 | genetic | 27708008 | |
| RNA15_YEAST | RNA15 | genetic | 27708008 | |
| TAF6_YEAST | TAF6 | genetic | 27708008 | |
| SPC97_YEAST | SPC97 | genetic | 27708008 | |
| CFT2_YEAST | CFT2 | genetic | 27708008 | |
| GPI12_YEAST | GPI12 | genetic | 27708008 | |
| GPI15_YEAST | GPI15 | genetic | 27708008 | |
| CAP_YEAST | SRV2 | genetic | 27708008 | |
| HRP1_YEAST | HRP1 | genetic | 27708008 | |
| RPB2_YEAST | RPB2 | genetic | 27708008 | |
| TIM50_YEAST | TIM50 | genetic | 27708008 | |
| ARP7_YEAST | ARP7 | genetic | 27708008 | |
| ATC3_YEAST | DRS2 | genetic | 27708008 | |
| RER1_YEAST | RER1 | genetic | 27708008 | |
| MTU1_YEAST | SLM3 | genetic | 27708008 | |
| AP18A_YEAST | YAP1801 | genetic | 27708008 | |
| DAL81_YEAST | DAL81 | genetic | 27708008 | |
| VPS27_YEAST | VPS27 | genetic | 27708008 | |
| HAT1_YEAST | HAT1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...