UniProt ID | YL162_YEAST | |
---|---|---|
UniProt AC | Q06235 | |
Protein Name | Protein YLR162W | |
Gene Name | YLR162W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 118 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | Overexpression confers resistance to the antimicrobial peptide MiAMP1.. | |
Protein Sequence | MQHTLTRTASLPERSSSAHSAATALPALRRPPDSCETLVPLLCIFWFVFVSMSPLPPARANKSDNKGLISADRNNKATLLLTIPRCTSKSYTNDLSPLKMTLLSAGKHPRPFRQEHRC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MQHTLTRTASL ----CCCCCEECCCC | 16.97 | 27017623 | |
6 | Phosphorylation | --MQHTLTRTASLPE --CCCCCEECCCCCC | 27.42 | 27017623 | |
8 | Phosphorylation | MQHTLTRTASLPERS CCCCCEECCCCCCCC | 18.50 | 27017623 | |
10 | Phosphorylation | HTLTRTASLPERSSS CCCEECCCCCCCCCC | 43.79 | 27017623 | |
23 | Phosphorylation | SSAHSAATALPALRR CCHHHHHHHHHHHHC | 28.57 | 19779198 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL162_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL162_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL162_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...