| UniProt ID | YJ127_YEAST | |
|---|---|---|
| UniProt AC | Q3E828 | |
| Protein Name | UPF0618 protein YJL127C-B | |
| Gene Name | YJL127C-B | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 52 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MIFFFNQIRSIFTALHTPTQQIQLSRRAFFQFLGYLGSCVVISLAAQSKYVQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of YJ127_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJ127_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJ127_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJ127_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| YRB30_YEAST | YRB30 | genetic | 27708008 | |
| MOB2_YEAST | MOB2 | genetic | 27708008 | |
| MOB1_YEAST | MOB1 | genetic | 27708008 | |
| MCM10_YEAST | MCM10 | genetic | 27708008 | |
| FNTA_YEAST | RAM2 | genetic | 27708008 | |
| TAD3_YEAST | TAD3 | genetic | 27708008 | |
| MED11_YEAST | MED11 | genetic | 27708008 | |
| ROT1_YEAST | ROT1 | genetic | 27708008 | |
| GPI12_YEAST | GPI12 | genetic | 27708008 | |
| RIB2_YEAST | RIB2 | genetic | 27708008 | |
| SEC63_YEAST | SEC63 | genetic | 27708008 | |
| GEM1_YEAST | GEM1 | genetic | 27708008 | |
| TPS2_YEAST | TPS2 | genetic | 27708008 | |
| ARO1_YEAST | ARO1 | genetic | 27708008 | |
| AP2_YEAST | CAD1 | genetic | 27708008 | |
| MMS2_YEAST | MMS2 | genetic | 27708008 | |
| AAKG_YEAST | SNF4 | genetic | 27708008 | |
| PUR4_YEAST | ADE6 | genetic | 27708008 | |
| MVB12_YEAST | MVB12 | genetic | 27708008 | |
| REXO1_YEAST | RNH70 | genetic | 27708008 | |
| OAF3_YEAST | OAF3 | genetic | 27708008 | |
| MLP1_YEAST | MLP1 | genetic | 27708008 | |
| PEX30_YEAST | PEX30 | genetic | 27708008 | |
| TOM7_YEAST | TOM7 | genetic | 27708008 | |
| APJ1_YEAST | APJ1 | genetic | 27708008 | |
| 2A5D_YEAST | RTS1 | genetic | 27708008 | |
| SYC1_YEAST | SYC1 | genetic | 27708008 | |
| VTS1_YEAST | VTS1 | genetic | 27708008 | |
| RS9A_YEAST | RPS9A | genetic | 27708008 | |
| YP257_YEAST | YPL257W | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...