VPS25_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: VPS25_HUMAN
• UniProt AC: Q9BRG1
• Protein Name: Vacuolar protein-sorting-associated protein 25
• Gene Name: VPS25
• Organism: Homo sapiens (Human).
• Sequence Length: 176
• Subcellular Localization: Cytoplasm. Endosome membrane. Nucleus, nucleoplasm. Distributes diffusely throughout the cytoplasm and nucleoplasm, but exhibits a punctate distribution on coexpression with CHMP6.
• Protein Description: Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation, possibly via its interaction with ELL. The ESCRT-II complex may be involved in facilitating the budding of certain RNA viruses..
• Protein Sequence: MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLFNNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQNNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MAMSFEWPWQY ----CCCCCCCCCCC	15.52	24719451
64	Ubiquitination	SPLFNNVKLQRKLPV CCCCCCCCCCCCCCH	40.81	21906983
84	Ubiquitination	VLEELRKKGNLEWLD HHHHHHHCCCCHHHH	46.74	-
92	Ubiquitination	GNLEWLDKSKSSFLI CCCHHHHCCCCCEEE	58.58	21890473
93	Phosphorylation	NLEWLDKSKSSFLIM CCHHHHCCCCCEEEE	37.12	29396449
94	Ubiquitination	LEWLDKSKSSFLIMW CHHHHCCCCCEEEEE	56.72	-
95	Phosphorylation	EWLDKSKSSFLIMWR HHHHCCCCCEEEEEE	33.15	23882029
109	Ubiquitination	RRPEEWGKLIYQWVS ECHHHHHHHHHHHHH	32.55	21890473
112	Phosphorylation	EEWGKLIYQWVSRSG HHHHHHHHHHHHHCC	13.52	25147952
116	Phosphorylation	KLIYQWVSRSGQNNS HHHHHHHHHCCCCCC	20.12	20068231
161	Ubiquitination	QALQQEHKAEIITVS HHHHHHHCCEEEEEE	47.14	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of VPS25_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of VPS25_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of VPS25_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RHXF2_HUMAN	RHOXF2	physical	16189514
VPS25_HUMAN	VPS25	physical	16371348
SNF8_HUMAN	SNF8	physical	16371348
VPS36_HUMAN	VPS36	physical	16371348
SNF8_YEAST	SNF8	physical	16371348
VPS36_YEAST	VPS36	physical	16371348
CHMP6_HUMAN	CHMP6	physical	16371348
SNF8_HUMAN	SNF8	physical	16973552
VPS36_HUMAN	VPS36	physical	16973552
CHMP6_HUMAN	CHMP6	physical	16973552
SNF8_HUMAN	SNF8	physical	14505570
VPS36_HUMAN	VPS36	physical	14505570
SPY2_HUMAN	SPRY2	physical	21543492
VPS28_HUMAN	VPS28	physical	21543492
VPS36_HUMAN	VPS36	physical	17010938
VPS36_HUMAN	VPS36	physical	22939629
VPS29_HUMAN	VPS29	physical	22939629
VPS35_HUMAN	VPS35	physical	22939629
ZFR_HUMAN	ZFR	physical	22939629
YAP1_HUMAN	YAP1	physical	22939629
GDE_HUMAN	AGL	physical	22863883
SYEP_HUMAN	EPRS	physical	22863883
OSGEP_HUMAN	OSGEP	physical	22863883
PP2BB_HUMAN	PPP3CB	physical	22863883
TRUA_HUMAN	PUS1	physical	22863883
SP100_HUMAN	SP100	physical	22863883
TBCD_HUMAN	TBCD	physical	22863883
TES_HUMAN	TES	physical	22863883
VPS36_HUMAN	VPS36	physical	22863883
WDR12_HUMAN	WDR12	physical	22863883
WDR92_HUMAN	WDR92	physical	22863883
SNF8_HUMAN	SNF8	physical	26344197

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.