UniProt ID | TP4A2_HUMAN | |
---|---|---|
UniProt AC | Q12974 | |
Protein Name | Protein tyrosine phosphatase type IVA 2 | |
Gene Name | PTP4A2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 167 | |
Subcellular Localization | Cell membrane. Early endosome. Cytoplasm. | |
Protein Description | Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. Promotes tumors. Inhibits geranylgeranyl transferase type II activity by blocking the association between RABGGTA and RABGGTB.. | |
Protein Sequence | MNRPAPVEISYENMRFLITHNPTNATLNKFTEELKKYGVTTLVRVCDATYDKAPVEKEGIHVLDWPFDDGAPPPNQIVDDWLNLLKTKFREEPGCCVAVHCVAGLGRAPVLVALALIECGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFRDTNGHCCVQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
11 | Phosphorylation | PAPVEISYENMRFLI CCCEEEEECCEEEEE | 19.58 | - | |
23 | Phosphorylation | FLITHNPTNATLNKF EEEECCCCCCHHHHH | 42.68 | 23186163 | |
26 | Phosphorylation | THNPTNATLNKFTEE ECCCCCCHHHHHHHH | 32.69 | 23186163 | |
29 (in isoform 2) | Ubiquitination | - | 57.69 | 21890473 | |
29 (in isoform 1) | Ubiquitination | - | 57.69 | 21890473 | |
29 | Ubiquitination | PTNATLNKFTEELKK CCCCHHHHHHHHHHH | 57.69 | 23000965 | |
29 | Malonylation | PTNATLNKFTEELKK CCCCHHHHHHHHHHH | 57.69 | 26320211 | |
35 | Ubiquitination | NKFTEELKKYGVTTL HHHHHHHHHCCCEEE | 47.42 | 23000965 | |
36 | Ubiquitination | KFTEELKKYGVTTLV HHHHHHHHCCCEEEE | 60.92 | 23000965 | |
36 (in isoform 2) | Ubiquitination | - | 60.92 | 21890473 | |
36 (in isoform 1) | Ubiquitination | - | 60.92 | 21890473 | |
49 | Phosphorylation | LVRVCDATYDKAPVE EEEECCCCCCCCCCC | 20.99 | 28796482 | |
50 | Phosphorylation | VRVCDATYDKAPVEK EEECCCCCCCCCCCC | 19.71 | 28796482 | |
52 | Acetylation | VCDATYDKAPVEKEG ECCCCCCCCCCCCCC | 44.14 | 27452117 | |
57 | Ubiquitination | YDKAPVEKEGIHVLD CCCCCCCCCCEEEEE | 62.57 | 29967540 | |
110 | Ubiquitination | AGLGRAPVLVALALI CCCCHHHHHHHHHHH | 7.01 | 21890473 | |
110 | Ubiquitination | AGLGRAPVLVALALI CCCCHHHHHHHHHHH | 7.01 | 23000965 | |
116 | Ubiquitination | PVLVALALIECGMKY HHHHHHHHHHCCCCH | 3.35 | 23000965 | |
117 | Ubiquitination | VLVALALIECGMKYE HHHHHHHHHCCCCHH | 3.24 | 21890473 | |
117 | Ubiquitination | VLVALALIECGMKYE HHHHHHHHHCCCCHH | 3.24 | 21890473 | |
121 | Ubiquitination | LALIECGMKYEDAVQ HHHHHCCCCHHHHHH | 6.72 | 23000965 | |
123 | Ubiquitination | LIECGMKYEDAVQFI HHHCCCCHHHHHHHH | 15.34 | 21890473 | |
127 | Ubiquitination | GMKYEDAVQFIRQKR CCCHHHHHHHHHHHH | 8.05 | 23000965 | |
140 | Phosphorylation | KRRGAFNSKQLLYLE HHCCCCCHHHHHHHH | 18.48 | 19835603 | |
141 | Acetylation | RRGAFNSKQLLYLEK HCCCCCHHHHHHHHH | 46.17 | 26051181 | |
141 (in isoform 1) | Ubiquitination | - | 46.17 | 21890473 | |
141 | Ubiquitination | RRGAFNSKQLLYLEK HCCCCCHHHHHHHHH | 46.17 | 23000965 | |
145 | Phosphorylation | FNSKQLLYLEKYRPK CCHHHHHHHHHHCCC | 22.77 | 22817900 | |
148 | Ubiquitination | KQLLYLEKYRPKMRL HHHHHHHHHCCCCEE | 43.92 | 21890473 | |
152 | Ubiquitination | YLEKYRPKMRLRFRD HHHHHCCCCEEEEEC | 27.88 | 23000965 | |
164 | Farnesylation | FRDTNGHCCVQ---- EECCCCCCCCC---- | 2.29 | 9018080 | |
164 | Methylation | FRDTNGHCCVQ---- EECCCCCCCCC---- | 2.29 | - | |
164 | Farnesylation | FRDTNGHCCVQ---- EECCCCCCCCC---- | 2.29 | 9018080 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TP4A2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TP4A2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TP4A2_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Prenylation | |
Reference | PubMed |
"Interaction of farnesylated PRL-2, a protein-tyrosine phosphatase,with the beta-subunit of geranylgeranyltransferase II."; Si X., Zeng Q., Ng C.H., Hong W., Pallen C.J.; J. Biol. Chem. 276:32875-32882(2001). Cited for: INTERACTION WITH RABGGTB, ISOPRENYLATION AT CYS-164, SUBCELLULARLOCATION, AND MUTAGENESIS OF 164-CYS--GLN-167 AND CYS-165. | |
"Prenylation of oncogenic human PTP(CAAX) protein tyrosinephosphatases."; Cates C.A., Michael R.L., Stayrook K.R., Harvey K.A., Burke Y.D.,Randall S.K., Crowell P.L., Crowell D.N.; Cancer Lett. 110:49-55(1996). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ISOPRENYLATION AT CYS-164, ANDENZYME REGULATION. |