UniProt ID | TP4A1_HUMAN | |
---|---|---|
UniProt AC | Q93096 | |
Protein Name | Protein tyrosine phosphatase type IVA 1 | |
Gene Name | PTP4A1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 173 | |
Subcellular Localization | Cell membrane. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm, cytoskeleton, spindle. And mitotic spindle. | |
Protein Description | Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.. | |
Protein Sequence | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
15 | Ubiquitination | APVEVTYKNMRFLIT CCEEEEECCCEEEEE | 34.60 | 21890473 | |
26 | Phosphorylation | FLITHNPTNATLNKF EEEECCCCHHHHHHH | 42.68 | 23186163 | |
29 | Phosphorylation | THNPTNATLNKFIEE ECCCCHHHHHHHHHH | 32.69 | 23186163 | |
32 | Ubiquitination | PTNATLNKFIEELKK CCHHHHHHHHHHHHH | 51.32 | 21890473 | |
38 | Ubiquitination | NKFIEELKKYGVTTI HHHHHHHHHCCCEEE | 47.42 | - | |
52 | Phosphorylation | IVRVCEATYDTTLVE EEEEEECCCCCEEEE | 10.31 | 29978859 | |
53 | Phosphorylation | VRVCEATYDTTLVEK EEEEECCCCCEEEEE | 20.52 | 25159151 | |
55 | Phosphorylation | VCEATYDTTLVEKEG EEECCCCCEEEEECC | 16.18 | 29978859 | |
56 | Phosphorylation | CEATYDTTLVEKEGI EECCCCCEEEEECCE | 26.38 | 29978859 | |
86 | Phosphorylation | QIVDDWLSLVKIKFR CCHHHHHHHEECEEC | 27.19 | 24719451 | |
143 | Phosphorylation | KRRGAFNSKQLLYLE HHCCCCCHHHHHHHH | 18.48 | 19835603 | |
144 | Ubiquitination | RRGAFNSKQLLYLEK HCCCCCHHHHHHHHH | 46.17 | 21890473 | |
148 | Phosphorylation | FNSKQLLYLEKYRPK CCHHHHHHHHHHCCC | 22.77 | 22817900 | |
151 | Ubiquitination | KQLLYLEKYRPKMRL HHHHHHHHHCCCCEE | 43.92 | 21890473 | |
161 | Ubiquitination | PKMRLRFKDSNGHRN CCCEEEEECCCCCCC | 54.54 | - | |
170 | Methylation | SNGHRNNCCIQ---- CCCCCCCCEEC---- | 2.17 | - | |
170 | Farnesylation | SNGHRNNCCIQ---- CCCCCCCCEEC---- | 2.17 | 9018080 | |
170 | Farnesylation | SNGHRNNCCIQ---- CCCCCCCCEEC---- | 2.17 | 9018080 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TP4A1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TP4A1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TP4A1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Prenylation | |
Reference | PubMed |
"Prenylation of oncogenic human PTP(CAAX) protein tyrosinephosphatases."; Cates C.A., Michael R.L., Stayrook K.R., Harvey K.A., Burke Y.D.,Randall S.K., Crowell P.L., Crowell D.N.; Cancer Lett. 110:49-55(1996). Cited for: NUCLEOTIDE SEQUENCE [MRNA], ENZYME ACTIVITY, AND ISOPRENYLATION ATCYS-170. |