UniProt ID | A7L3B_HUMAN | |
---|---|---|
UniProt AC | Q96GX2 | |
Protein Name | Ataxin-7-like protein 3B | |
Gene Name | ATXN7L3B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 97 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | By binding to ENY2, interferes with the nuclear functions of the deubiquitinase (DUB) module of the SAGA complex which consists of ENY2, ATXN7, ATXN7L3 and the histone deubiquitinating component USP22. Affects USP22 DUB activity toward histones indirectly by changing the subcellular distribution of ENY2 and altering ENY2 availability for ATXN7L3 interaction. Regulates H2B monoubiquitination (H2Bub1) levels through cytoplasmic sequestration of ENY2 resulting in loss of nuclear ENY2-ATXN7L3 association which destabilizes ATXN7L3. Affects protein expression levels of ENY2 and ATXN7L3.. | |
Protein Sequence | MEEISLANLDTNKLEAIAQEIYVDLIEDSCLGFCFEVHRAVKCGYFYLEFAETGSVKDFGIQPVEDKGACRLPLCSLPGEPGNGPDQQLQRSPPEFQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MEEISLANLDTN ---CCCEECCCCCHH | 25.39 | 26074081 | |
11 | Phosphorylation | ISLANLDTNKLEAIA EECCCCCHHHHHHHH | 37.10 | 26074081 | |
45 | Phosphorylation | HRAVKCGYFYLEFAE HHHHHCCEEEEEEEE | 9.87 | - | |
47 | Phosphorylation | AVKCGYFYLEFAETG HHHCCEEEEEEEECC | 9.24 | - | |
67 | Acetylation | GIQPVEDKGACRLPL CCCCCCCCCCEECEE | 34.60 | 23749302 | |
67 | Ubiquitination | GIQPVEDKGACRLPL CCCCCCCCCCEECEE | 34.60 | 33845483 | |
76 | Phosphorylation | ACRLPLCSLPGEPGN CEECEECCCCCCCCC | 45.33 | 20068231 | |
92 | Phosphorylation | PDQQLQRSPPEFQ-- CCHHHHCCCCCCC-- | 31.67 | 23401153 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of A7L3B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of A7L3B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of A7L3B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ENY2_HUMAN | ENY2 | physical | 27601583 | |
UBP22_HUMAN | USP22 | physical | 27601583 | |
TAF6L_HUMAN | TAF6L | physical | 27601583 | |
TAF10_HUMAN | TAF10 | physical | 27601583 | |
TADA3_HUMAN | TADA3 | physical | 27601583 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...