| UniProt ID | TMPS3_HUMAN | |
|---|---|---|
| UniProt AC | P57727 | |
| Protein Name | Transmembrane protease serine 3 | |
| Gene Name | TMPRSS3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 454 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type II membrane protein . |
|
| Protein Description | Probable serine protease that plays a role in hearing. Acts as a permissive factor for cochlear hair cell survival and activation at the onset of hearing and is required for saccular hair cell survival (By similarity). Activates ENaC (in vitro).. | |
| Protein Sequence | MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | PAVEAPFSFRSLFGL CCCCCCCCHHHHHCC | 20.77 | 24719451 | |
| 99 | Ubiquitination | CDGVSDCKDGEDEYR CCCCCCCCCCCCCEE | 73.99 | 21963094 | |
| 99 (in isoform 1) | Ubiquitination | - | 73.99 | 21906983 | |
| 99 (in isoform 3) | Ubiquitination | - | 73.99 | 21906983 | |
| 99 (in isoform 4) | Ubiquitination | - | 73.99 | 21906983 | |
| 124 | Phosphorylation | LQVFTAASWKTMCSD EEEEEHHHHHCCCCC | 27.00 | 24719451 | |
| 168 | Ubiquitination | LEGQFREEFVSIDHL CCCCCHHHEECHHHC | 47.28 | 29967540 | |
| 183 (in isoform 5) | Ubiquitination | - | 14.11 | 21906983 | |
| 187 | Phosphorylation | KVTALHHSVYVREGC CCEEEEEEEEEECCC | 12.37 | 29083192 | |
| 189 | Phosphorylation | TALHHSVYVREGCAS EEEEEEEEEECCCCC | 9.23 | 29083192 | |
| 221 | N-linked_Glycosylation | SSRIVGGNMSLLSQW CCCEECCCCHHHHCC | 15.79 | UniProtKB CARBOHYD | |
| 295 | Ubiquitination | EKIVYHSKYKPKRLG HHHHHCCCCCCHHCC | 43.94 | 29967540 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TMPS3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TMPS3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TMPS3_HUMAN !! | ||||||
loading...
