| UniProt ID | UPK3L_HUMAN | |
|---|---|---|
| UniProt AC | B0FP48 | |
| Protein Name | Uroplakin-3b-like protein 1 {ECO:0000312|HGNC:HGNC:37278} | |
| Gene Name | UPK3BL1 {ECO:0000312|HGNC:HGNC:37278} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 263 | |
| Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MDNSWRLGPAIGLSAGQSQLLVSLLLLLTRVQPGTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVVIIAILSILLAVLLTVLLAVLIYTCFNSCRSTSLSGPEEAGSVRRYTTHLAFSTPAEGAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Phosphorylation | AAPEHISYVPQLSND CCCHHCCCCCCCCCC | 18.62 | 26437602 | |
| 51 | N-linked_Glycosylation | SYVPQLSNDTLAGRL CCCCCCCCCCHHCEE | 55.68 | UniProtKB CARBOHYD | |
| 76 | N-linked_Glycosylation | LGQFSSHNISDLDTI CCCCCCCCCCCCCHH | 37.09 | UniProtKB CARBOHYD | |
| 91 | N-linked_Glycosylation | WLVVALSNATQSFTA HHEEHHHCCCCCCCC | 48.10 | UniProtKB CARBOHYD | |
| 112 | Phosphorylation | IPAPANFSQRGYYLT CCCCCCCCCCCEEEE | 20.83 | 23532336 | |
| 148 | Ubiquitination | DTHCQPTKIGCNHPL CCCCCCCCCCCCCCC | 43.73 | - | |
| 164 | Ubiquitination | GPGPYRVKFLVMNDE CCCCEEEEEEEECCC | 24.79 | 21890473 | |
| 178 | Ubiquitination | EGPVAETKWSSDTRL CCCCCCCCCCCCCHH | 36.26 | - | |
| 231 | Phosphorylation | LIYTCFNSCRSTSLS HHHHHHHHHHCCCCC | 7.23 | 24719451 | |
| 245 | Phosphorylation | SGPEEAGSVRRYTTH CCCCHHCCCEEEEEE | 21.35 | 28857561 | |
| 249 | Phosphorylation | EAGSVRRYTTHLAFS HHCCCEEEEEEEEEC | 12.86 | - | |
| 251 | Phosphorylation | GSVRRYTTHLAFSTP CCCEEEEEEEEECCC | 13.12 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UPK3L_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of UPK3L_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UPK3L_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of UPK3L_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
