dbPTM

SMAD1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SMAD1_MOUSE
UniProt AC	P70340
Protein Name	Mothers against decapentaplegic homolog 1
Gene Name	Smad1
Organism	Mus musculus (Mouse).
Sequence Length	465
Subcellular Localization	Cytoplasm . Nucleus . In the cytoplasm in the absence of ligand. Migration to the nucleus when complexed with SMAD4. Colocalizes with LEMD3 at the nucleus inner membrane. Exported from the nucleus to the cytoplasm when dephosphorylated (PubMed:257552
Protein Description	Transcriptional modulator activated by BMP (bone morphogenetic proteins) type 1 receptor kinase. SMAD1 is a receptor-regulated SMAD (R-SMAD) (By similarity). May play a role in the initiation and maintenance of spermatogenesis. SMAD1/OAZ1/PSMB4 complex mediates the degradation of the CREBBP/EP300 repressor SNIP1 (By similarity). May act synergistically with SMAD4 and YY1 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression. [PubMed: 15329343]
Protein Sequence	MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQPMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
1	Acetylation	-------MNVTSLFS -------CCCCCCEE	9.09	-
5	Phosphorylation	---MNVTSLFSFTSP ---CCCCCCEECCCH	24.12	26643407
8	Phosphorylation	MNVTSLFSFTSPAVK CCCCCCEECCCHHHH	32.67	26643407
10	Phosphorylation	VTSLFSFTSPAVKRL CCCCEECCCHHHHHH	32.38	28066266
11	Phosphorylation	TSLFSFTSPAVKRLL CCCEECCCHHHHHHH	14.62	28066266
70	Phosphorylation	NCVTIPRSLDGRLQV CEEEECCCCCCCEEE	26.00	20139300
78	Phosphorylation	LDGRLQVSHRKGLPH CCCCEEEECCCCCCE	12.47	25338131
88	Phosphorylation	KGLPHVIYCRVWRWP CCCCEEEEEEEEECC	3.52	29514104
132	Phosphorylation	YHYKRVESPVLPPVL CCCCCCCCCCCCCEE	19.90	26824392
144	Phosphorylation	PVLVPRHSEYNPQHS CEECCCCCCCCCCCC	42.95	-
146	Phosphorylation	LVPRHSEYNPQHSLL ECCCCCCCCCCCCHH	34.85	29514104
321	Phosphorylation	LSNVNRNSTIENTRR HCCCCCCCCCHHHHH	27.76	30635358
322	Phosphorylation	SNVNRNSTIENTRRH CCCCCCCCCHHHHHH	35.54	23684622
326	Phosphorylation	RNSTIENTRRHIGKG CCCCCHHHHHHCCCC	19.11	23684622
462	Phosphorylation	GSPHNPISSVS---- CCCCCCCCCCC----	26.41	25619855
463	Phosphorylation	SPHNPISSVS----- CCCCCCCCCC-----	27.40	26824392
465	Phosphorylation	HNPISSVS------- CCCCCCCC-------	36.13	26824392

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
322	T	Phosphorylation	Kinase	MAP4K4	P97820	Uniprot
322	T	Phosphorylation	Kinase	MINK1	Q9JM52	Uniprot
322	T	Phosphorylation	Kinase	TNIK	P83510	Uniprot
-	K	Ubiquitination	E3 ubiquitin ligase	Smurf1	Q9CUN6	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SMAD1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SMAD1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SMUF1_MOUSE	Smurf1	physical	12370310
ZEB2_MOUSE	Zeb2	physical	20211142
EVI1_MOUSE	Mecom	physical	15849193
SMRD3_MOUSE	Smarcd3	physical	15525990
SUV92_MOUSE	Suv39h2	physical	15107829
ERCC3_MOUSE	Ercc3	physical	16101586
BACH1_MOUSE	Bach1	physical	16101586
KLF10_MOUSE	Klf10	physical	16101586
PRS6A_MOUSE	Psmc3	physical	16101586
SMAD9_MOUSE	Smad9	physical	16101586
CXB6_MOUSE	Gjb6	physical	16101586
MXI1_MOUSE	Mxi1	physical	16101586
MYOD1_MOUSE	Myod1	physical	11711431
HXD13_MOUSE	Hoxd13	physical	16087734
RUNX2_MOUSE	Runx2	physical	12738770
PEX6_MOUSE	Pex6	physical	14651998
4ET_MOUSE	Eif4enif1	physical	14651998
ZMYM2_MOUSE	Zmym2	physical	14651998
PRD16_MOUSE	Prdm16	physical	17467076
SMUF2_MOUSE	Smurf2	physical	20956305

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SMAD1_MOUSE

Related Literatures of Post-Translational Modification