CXB6_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CXB6_MOUSE
• UniProt AC: P70689
• Protein Name: Gap junction beta-6 protein
• Gene Name: Gjb6
• Organism: Mus musculus (Mouse).
• Sequence Length: 261
• Subcellular Localization: Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
• Protein Description: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell..
• Protein Sequence: MDWGTLHTVIGGVNKHSTSIGKVWITVIFIFRVMILVVAAQEVWGDEQEDFVCNTLQPGCKNVCYDHFFPVSHIRLWALQLIFVSTPALLVAMHVAYYRHETARKFIRGEKRNEFKDLEDIKRQKVRIEGSLWWTYTSSIFFRIIFEAAFMYVFYFLYNGYHLPWVLKCGIDPCPNLVDCFISRPTEKTVFTVFMISASVICMLLNVAELCYLLLKLCFRRSKRTQAQRNHPNHALKESKQNEMNELISDSGQNAITSFPS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Ubiquitination	GEKRNEFKDLEDIKR CCCCCCCCCHHHHHH	56.05	22790023
239	Phosphorylation	PNHALKESKQNEMNE CCHHHHHHHHHHHHH	37.64	29899451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CXB6_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CXB6_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CXB6_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CXB6_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.